KEGG   Magnaporthe oryzae: MGG_07268Help
Entry
MGG_07268         CDS       T01027                                 

Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00020  Citrate cycle (TCA cycle)
mgr00480  Glutathione metabolism
mgr01100  Metabolic pathways
mgr01110  Biosynthesis of secondary metabolites
mgr01130  Biosynthesis of antibiotics
mgr01200  Carbon metabolism
mgr01210  2-Oxocarboxylic acid metabolism
mgr01230  Biosynthesis of amino acids
mgr04146  Peroxisome
Module
mgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mgr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MGG_07268
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MGG_07268
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MGG_07268
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MGG_07268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 2683014
NCBI-ProteinID: XP_003715491
UniProt: G4MUJ2
LinkDB All DBs
Position
2
AA seq 450 aa AA seqDB search
MRPAASRVFGQSAFLARQSLLRPQQQQQLYAAQFMRTMASQAKIKVKNPVVELDGDEMTR
IIWQNIKDKFIHPYLDIDLKYYDLGLEYRDKTDDKVTLDAAEAIKKYSVGVKCATITPDE
ARVKEFNLKQMWLSPNGTIRNALGGTVFREPIVIPRIPRLVPSWQKPIIIGRHAFGDQYR
AKDMVVPGEGKLTMTFTPKGGEPQEIQVFDFKNGGGVAQTQYNTDESITGFAHSSFKLAL
AKGLPLYMSTKNTILKKYDGRFKDIFEQLYQSTYKAEFEAKGIWYEHRLIDDMVAQMIKS
TGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGTVTRHYREHQK
GRETSTNPIASIFAWTRGLIQRGKLDETPDVVAFAETLERACIETVDIDGIMTKDLALAC
GKTARSDYVTTNEYLDAVERRMKSSLKEKL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccggccgcctcccgcgtttttggtcaatcggccttcctcgctcgtcaatcgcta
ctccgtccgcagcagcagcagcagctttacgccgcccagttcatgcgtacaatggcgtcc
caggccaagatcaaggtcaagaacccagtcgtcgagctggacggcgacgagatgacccgc
atcatctggcagaacatcaaggacaagttcatccacccttacctcgacatcgacctcaag
tactacgacctcgggctcgagtaccgcgacaagaccgatgacaaggtcactctggacgcc
gcagaggccatcaagaagtactcggttggtgtcaagtgcgccaccatcacccccgacgag
gcccgtgtcaaggagttcaacctcaagcagatgtggctctcccccaacggcaccatccgt
aatgctctgggcggcaccgtcttccgggagccgatcgtgatcccgcgtattccgcgcctg
gtgccgagctggcagaagcccatcatcatcggccgccacgcctttggcgaccagtaccgc
gccaaggacatggtcgtgcccggcgagggcaagctgaccatgaccttcacccccaagggc
ggcgagccgcaggagatccaggtctttgacttcaagaacggcggcggcgtcgcgcagacc
cagtacaacaccgatgagagcatcacgggctttgcccactcaagcttcaagctcgccctc
gccaagggtctgccgttgtacatgagcaccaagaacaccatcctcaagaagtacgacggc
cgcttcaaggacatctttgagcagctgtaccagtcgacctacaaggccgagttcgaggcc
aagggcatctggtacgagcaccgcctgatcgacgacatggtcgcccagatgatcaagagc
acaggcggctacatcatggctctgaagaactacgacggtgacgtccagtccgacattgtc
gcccagggcttcggctccctcggcctgatgacctcggtcctcatcactcccgacggcaag
accttcgagtccgaggccgcacacggcaccgtgactcgccactaccgcgagcaccaaaag
ggtcgcgagacctcgaccaaccccatcgcctccatcttcgcctggacccgcggcctgatc
cagaggggcaagctggacgagactcccgacgtcgtcgcctttgccgagaccctcgagcgc
gcctgcatcgagacggtcgacattgacggcatcatgaccaaggacctcgccctcgcctgc
ggcaagaccgcccgcagcgactacgtcaccaccaacgagtacctcgatgctgtcgagagg
aggatgaagtcgagcctcaaggagaagctgtga

DBGET integrated database retrieval system