KEGG   Magnaporthe oryzae: MGG_07697Help
Entry
MGG_07697         CDS       T01027                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MGG_07697
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MGG_07697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 2683617
NCBI-ProteinID: XP_003711637
UniProt: G4N3F2
LinkDB All DBs
Position
3
AA seq 213 aa AA seqDB search
MASSTTYKLPELPFAYDALEPHISKQIMELHHSKHHAAYVANLNKALETYASGQLADRVA
TLAAINFNAGGHINHTLFWENLTPASSPDADAATSAPSLVTQIEKQWGSLDQFKAEFSAE
LLGIKGSGWGWLVKEKSAAGALVVVTTKDQDSVPSGIPVFGVDMWEHAYYLQYLNGKAAY
VENIWKVINWKTAEKRFASPGRSEVFKALHASL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcaagctcaaccacctacaagctccccgagctcccattcgcctacgacgccctggag
ccgcacatctccaagcagatcatggagctgcaccacagcaagcaccacgcggcctacgtg
gccaacctcaacaaggcgctcgagacgtacgcgtcgggccagctggcggaccgcgtcgcc
accctcgcggccatcaacttcaacgccggcggccacatcaaccacacgctcttctgggag
aacctgacgccggcgtcgagcccagacgccgacgccgccacgtcggcgccctcgctggtt
acgcagatcgagaagcagtggggcagcctcgaccaattcaaggcggagttctcggccgag
ctgctgggcatcaagggcagcggctggggctggctggtcaaggagaagtcggcggctggc
gcgctggtcgtcgtcaccaccaaggatcaggattccgtgccgagcgggatccccgtattt
ggcgttgacatgtgggagcatgcttactatcttcagtacctgaacggcaaggccgcctat
gtcgaaaacatttggaaggttatcaactggaaaactgccgaaaagaggttcgcgtcacca
gggcgttccgaggttttcaaagcactacatgcttccctgtaa

DBGET integrated database retrieval system