KEGG   Magnaporthe oryzae: MGG_09289Help
Entry
MGG_09289         CDS       T01027                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00010  Glycolysis / Gluconeogenesis
mgr00051  Fructose and mannose metabolism
mgr00052  Galactose metabolism
mgr00500  Starch and sucrose metabolism
mgr00520  Amino sugar and nucleotide sugar metabolism
mgr01100  Metabolic pathways
mgr01110  Biosynthesis of secondary metabolites
mgr01130  Biosynthesis of antibiotics
mgr01200  Carbon metabolism
Module
mgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mgr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGG_09289
   00051 Fructose and mannose metabolism
    MGG_09289
   00052 Galactose metabolism
    MGG_09289
   00500 Starch and sucrose metabolism
    MGG_09289
   00520 Amino sugar and nucleotide sugar metabolism
    MGG_09289
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MGG_09289
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgr04131]
    MGG_09289
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     MGG_09289
Membrane trafficking [BR:mgr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    MGG_09289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 2680167
NCBI-ProteinID: XP_003709938
UniProt: G4MQN9
LinkDB All DBs
Position
1
AA seq 481 aa AA seqDB search
MVDAPKDLVKEIKDLEEMFTVDTAKLKQITNHFVGELERGLSVEGGDIPMNPTWVMSFPD
GYETGTFLALDMGGTNLRVCEITLTDQKSEFDIIQSKYRMPEELKTGQSDELWDYIADCL
LQFIETHHGDPKKIEKLPLGFTFSYPATQNYVDEGILQRWTKGFDIAGVEGKNVAPMLMK
ALSERDRNQGVPVKLVALINDTTGTLIASAYTDTQMRIGCIFGTGCNAAYMEECGSIPKL
AHMNLPPETPMAINCEWGAFDNQHKVLPRTPYDVKIDEDSPRPGQQAFEKMIAGLYLGEI
FRLILVDLHDNHEVRIFKNQDISKLRRAYTLDSSFLSAIEDDPWENLSETLDLFQDKLNL
VPNRNELELIRRTAELIGTRAARLSACGVAAICKKKNYRSCHVGADGSVFNKYPNFKQRG
AQALREILDWPAKEDPKEEDPIEILAAEDGSGVGAALIAALTLKRAKEGNFHGISNPENF
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggtggacgctccgaaggatctcgtcaaggagatcaaggaccttgaggagatgttcact
gtagataccgccaagctcaagcaaatcaccaatcactttgtcggcgagcttgagcggggg
ttgagtgtagaaggcggggacattcctatgaaccctacgtgggtcatgtccttcccggac
ggctacgagaccgggacatttctggcccttgacatgggtggtacaaacctgagggtctgc
gaaatcacgctcactgaccagaagtcggagtttgacattatccaatccaaataccggatg
cccgaagagctcaagaccggccagtccgatgagctttgggactatatcgccgactgcctg
ctccagttcattgagactcaccatggagacccaaagaagattgagaagctgcctttgggc
ttcaccttctcttaccctgcaactcagaactacgtcgatgagggcatcctgcagcgatgg
actaaaggcttcgatatcgccggcgtcgaaggaaagaatgtcgcgccaatgctgatgaag
gcactgtctgagagggaccgcaaccagggcgtgcccgtcaaactcgtggctctgatcaac
gacaccactggcaccctcattgcctcggcttatacggacacccaaatgcgcattggctgc
atctttggcactggttgcaatgctgcttacatggaggaatgtggttctattcccaagctg
gcgcatatgaacctgcccccagagacgcccatggctatcaattgtgaatggggtgctttc
gacaaccagcacaaggttcttccgaggaccccctacgacgtgaaaatcgacgaggactct
ccccggcctggacaacaggcgttcgagaagatgatcgccggattatacctgggagagatt
ttccgtcttattctggttgacttgcatgacaaccatgaggtccgcatcttcaagaaccag
gacatctccaagttgcgacgcgcctacaccctcgactcgtcgttcctttcagctatcgag
gacgacccctgggagaacctgtccgagaccttggacctgttccaggacaagctcaacttg
gttcctaaccggaacgagctcgaactcatccgacgcactgcggagctgatcggcactcga
gctgccagactttcagcatgcggtgtggccgcaatctgcaagaagaagaactaccgctct
tgccatgtgggcgccgatggatctgtcttcaacaagtatcccaacttcaagcagcggggt
gcccaggccctcagggagatcctcgactggcctgcaaaggaggatcccaaggaggaggat
cctattgagattcttgcggctgaggatggcagtggtgtaggtgccgcgctcattgctgcg
ttgacgctaaagagggccaaagagggtaatttccacggcatcagcaacccagagaacttt
aagtga

DBGET integrated database retrieval system