KEGG   Magnaporthe oryzae: MGG_10662Help
Entry
MGG_10662         CDS       T01027                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00052  Galactose metabolism
mgr00500  Starch and sucrose metabolism
mgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MGG_10662
   00500 Starch and sucrose metabolism
    MGG_10662
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     MGG_10662
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 CARD
Motif
Other DBs
NCBI-GeneID: 2682275
NCBI-ProteinID: XP_003710096
UniProt: G4MS18
LinkDB All DBs
Position
1
AA seq 965 aa AA seqDB search
MANPNFKLQEKRQHQNALLENQPPVKSRPARKRGLTTGLLGLVLGTATIWLFFDAQLRTL
IAQWCQPRIGFPNPAAALAGCPGYVASNVEETSSSLTADLKLAGEACNVYGRDLAELKLL
VEYQTDKRLHVKIYDAKQQAYQIPESIIPSPQHQKTPSSQSEVTFHLTDSPFSFAVTRTG
NGEVLFNTSREQLIFEDQYIRLRTGLPSDPNLYGLGEHTDSFRLPTQDYHRTLWNADMAF
NPPMANMYSSHPTYFDHRPGSGTHAVYLRNSGGMDVKIHRTEADGQYLEYNLLGGVLDLY
LLAGPGPAEASRQYAETIGLADMPPYWALGIHQCKYGYWDVYMLAEVVANSSAAQIPLDV
LWSDIDSMDGRKDFTLDEARFPMDRMRQLIDTLHGRGQKFITMLDSAVSREANYAPYTRG
TAQDVFLKADDGSHYLGIQWPGVVVWPDWTAPNTQAWWTDEILRWFDPETGMDIDGLWND
MNEAANFCGNVGCDPEKDKGDNPPDPQFPPRPNTGRPIPGFPAEFQPDYNGSSRSIKIES
ITRVDSMHADNSIPELRRRDNVVAEMKGLPDRDLFYPKYKIQNRRGDISDGTLYTNISNY
DGSSQYDTHNFYGGTMALTTRKALATRNPTRRPFVLTRSAFAGAGHQVAHWFGDNVSTWR
DLRISILHMLAAAALQNMPVVGSDVCGFNGEAEERMCQRWTLAAAFQPFFRNHADLGSPH
QEFYLWESVAATARKAIRARYRLLDLLYTGVRSQTASGEPVVRPIFYVYPDDSDAVAVET
QWFLGPGAEVLISPVVEEGATRLDFYLPDDIFYDFWTLKKERGRGRVVAKENVGWDEIPV
HIRGGRILPLREHGTANTTAELRKENFVIVVAPGLDGTAAGSLYLDDGDSVDPRDEVTEV
AFSWDGTRFAASGKWGFDTELVVEEVLVLGQKKGSGLPGMIYDDEVGVVRVKGPWSLKGD
FGFSF
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaccctaacttcaagctccaggaaaagcggcagcatcaaaatgccttgctagaa
aatcagcctccggtcaaatcaagaccggcaaggaaaagaggcctcaccactggtctcctg
ggccttgttctaggaaccgccaccatctggctgttcttcgacgcccagctacgcactttg
attgcccaatggtgtcaacccaggatcggctttcccaatccggctgctgctcttgccggc
tgtccaggatatgtggcctccaatgtggaggagacgtcttcgtctctcaccgcggacctg
aagctcgctggagaggcatgcaacgtctacggcagggatttggccgagcttaagttgctt
gttgagtatcagacagacaagagactgcatgtcaaaatatacgacgcgaagcagcaagcc
taccagattccagagtcaatcatccctagtcctcagcatcaaaagaccccatcatcccaa
tctgaagtcaccttccacctcacagactccccattttccttcgcggttacccgcaccggt
aatggcgaggttcttttcaacacctcccgcgagcaactcatctttgaggaccagtacatt
cgcctccgtaccggacttccttctgatccgaatctgtacggcctcggggagcataccgac
agcttccgcctgccgacccaggactaccaccgcacgctatggaacgccgacatggccttc
aacccgcccatggcaaacatgtacagcagtcacccgacttactttgaccaccggcccggc
tccggcacgcacgctgtctacctgcgcaattcgggcggcatggacgtcaaaatacaccgc
accgaagccgacggccagtacctcgagtacaatctcttgggtggcgtcctggacttgtac
ctcctggccggcccaggcccagctgaggcgagcaggcagtatgccgagaccatcgggctt
gccgatatgccaccttactgggcgctcggtatccaccagtgcaaatacggctattgggac
gtctacatgctggcggaggtggttgccaactcatcagccgctcagatcccgcttgacgtt
ctgtggtccgatatcgattccatggacggccgcaaggactttacccttgatgaggcccga
ttccccatggacagaatgcgccagcttatcgacaccctgcacggccgcggccaaaagttt
atcacaatgctggactcggccgtgtcgcgcgaggccaattacgccccgtacacgcgtggc
acagctcaagacgtcttcctcaaggccgacgacggaagccattacctgggaatacagtgg
cccggagtcgtggtctggccggactggactgcgccgaacacgcaagcctggtggaccgac
gagatcttgcgctggtttgacccagagacgggcatggacatcgatgggctatggaacgat
atgaacgaagcggcaaacttctgcgggaacgtcggctgcgacccggagaaggacaagggc
gacaatccgccagacccacaatttcctccgcgacccaacaccggacggcctatccctggc
ttcccggccgagtttcagccggattacaatggcagtagccgtagcatcaagatcgaatcc
ataactcgtgttgacagcatgcatgcggacaactcgatccccgaactccgccgccgtgac
aatgtggtagcggaaatgaagggcctcccggaccgcgatctgttctatcccaagtacaag
atccaaaaccggcgcggcgatatatcagacggcacactatacacaaacatcagcaactat
gacggctcatctcagtacgatacccacaacttttacggcggcaccatggcacttacaacc
cgcaaagccctggctactcgcaacccgacgcgccgcccctttgttctcacgcgatccgcc
ttcgcaggggccggtcaccaggttgcccactggttcggtgacaatgtgtccacgtggcga
gacctccgcatctcgattctgcacatgctggctgcggccgcgttacaaaacatgccagtc
gttggatcggacgtctgtggcttcaacggcgaggccgaggagcgcatgtgccagcgatgg
accctcgctgccgcattccagcccttcttcaggaaccatgccgaccttggctctcctcat
caggagttctacctctgggagagtgtggccgccaccgctaggaaggcgatccgcgcccgt
taccggcttcttgacctgctctacacgggcgtgaggtctcagacagcctcgggggagcca
gttgtcaggcctatattttatgtctaccccgatgacagtgatgcggttgctgtcgaaacg
cagtggttcctcggcccgggggctgaggtcctaatatcgcccgttgtggaagaaggagca
acaaggttggacttttaccttcccgacgacatcttttacgacttttggacgctcaagaag
gaacgtggacggggtcgggtggtcgcaaaggaaaatgtcggctgggatgagattcccgtg
cacatccgtggcggcagaattctgcctctccgggagcatggcacggccaatacgacggcc
gagctgcgcaaggagaattttgtcatcgttgttgctccagggctggacggcaccgccgcc
gggagtctgtatctggatgacggggacagtgtcgatcccagggatgaagtcaccgaggtt
gccttctcctgggatgggacgcggtttgctgcgtcgggtaaatggggctttgataccgag
cttgttgtggaggaggtcctggtgcttgggcaaaagaagggctctggcttgccgggaatg
atatatgacgatgaggtcggtgtggtgcgtgtaaaggggccctggagtctcaaaggagac
tttggctttagtttttga

DBGET integrated database retrieval system