KEGG   Magnaporthe oryzae: MGG_12767Help
Entry
MGG_12767         CDS       T01027                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00020  Citrate cycle (TCA cycle)
mgr00310  Lysine degradation
mgr00380  Tryptophan metabolism
mgr01100  Metabolic pathways
mgr01110  Biosynthesis of secondary metabolites
mgr01130  Biosynthesis of antibiotics
mgr01200  Carbon metabolism
Module
mgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MGG_12767
  09105 Amino acid metabolism
   00310 Lysine degradation
    MGG_12767
   00380 Tryptophan metabolism
    MGG_12767
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     MGG_12767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 5050140
NCBI-ProteinID: XP_003716844
UniProt: G4NAT3
LinkDB All DBs
Position
4
AA seq 1008 aa AA seqDB search
MLRINRTVRNVRPLASRAAARTVPCSRRWHATDSFLTGESADYRDEMYNQWRKNPESVHI
SWQIYFKNLESGKMPTAQAFQPPPSIVPSATGGVPSIAAGSSSEVTNHLKVQLLVRAYQA
RGHLKANIDPLGIRNESKGGFAIKPKELSLEHYQFTEADLDTEYSLGPGILPRFKKDGRE
KMTLREIIAACEKIYCGSYGVEFIHIPDREKCDWLRERLEVPQPFKYSIDEKRRILDRLI
WSSLFEIFLATKYPNDKRFGLEGCEALVPGMKALIDRSVDYGIKDIVIGMPHRGRLNVLS
NVVRKPNESIFSEFAGTTGAEEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAED
PVVLGKTRAIQHYNNDEKTHRTAMGVLLHGDAAIAGQGVVYECLGFHSLPGYSTGGTIHL
VVNNQIGFTTDPRFARSTAYCTDIAKAIDAPVFHVNADDVEAVNYMCQLAADWRAEFQQD
VIIDLVCYRKHGHNETDQPSFTQPLMYKKIQSKDSQLETYIKKLIEDGTFTKEDIEEHKK
WVWGMLEDSFSKSKEYQPTSKEWTTSAWNGFKSPKELATEVLPHNPTGVDKQTLQHIGEV
IGSAPETFNLHRNLKRILTNRTKTVVEGKNIDWSTAEALAFGSLVTEGHHVRVSGQDVER
GTFSQRHAVFHDQETEDTYTPLQNVSKDQAKFVISNSSLSEFGVLGFEYGYSLTSPNALV
MWEAQFGDFANNAQCVIDQFIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQL
CNEDPRDFPTGEKLMRQHQDCNMQIAYMTTPANLFHILRRQMTRQFRKPLIIFFSKALLR
HPLARSNIEDFTGDSQFQWIIPDPAHQTGEIKSNEEIDRVILCTGQVYTALHKHRADNQI
DNVAITRVEQLHPFPWDALRENLDQYPNAKTIVWAQEEPLNAGAWSYTQPRIETLLNQTQ
HHDRKHVMYAGRHPSASVATGLKSAHVKEEKELLEMAFSVKQDKLKGE
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcatcaaccggaccgtccggaacgtccggcctcttgcctctcgggcggcggcc
aggaccgttccgtgtagccgtcgttggcatgccaccgatagcttcctcactggcgagagc
gccgactaccgcgacgagatgtacaaccaatggaggaaaaacccagagagcgtgcacatc
tcatggcaaatatatttcaaaaacctagagtcgggcaagatgcccaccgctcaggccttc
caaccccctccatcaattgtgcccagtgcaactggcggcgttccaagtatcgcggccggc
tcttcttcagaggttacaaaccatctcaaggttcagctcctcgtccgcgcataccaggcc
cgcggtcatctcaaggccaatatcgacccgctcggcattcgtaacgagtccaagggcggc
tttgccatcaagcccaaggagctcagcttagagcactaccaattcaccgaggcagacctc
gacaccgagtactcgcttggccccggtatcctgccgcgcttcaagaaggacggccgcgaa
aagatgacactgcgcgagattatcgctgcttgcgagaagatatactgcggctcatatggt
gtcgagttcatccacatccctgaccgtgagaagtgcgactggctaagggaacgcctcgag
gttccccaaccattcaagtactcgatcgacgagaagcgcaggatcctcgaccgcctcatc
tggagctctctcttcgagattttcctggccacaaaataccccaacgacaagcgtttcggt
ctcgagggttgcgaggctctcgtccctggtatgaaggccctgatcgaccgtagcgtcgac
tacggcatcaaggacatcgtcattggtatgcctcatcgtggtcgtctcaacgtcctgagc
aacgtcgtcaggaaaccgaacgagtccattttcagcgagtttgccggcacaactggagcc
gaggagggttctggcgacgtcaagtaccatctgggcatgaacttcgagcgcccgactccc
tcaggcaagcgtgtgcaactgtccctggttgccaacccttcgcatcttgaggccgaggac
cctgtcgtcctcggaaagacccgcgctatccagcactacaacaacgacgagaagactcat
cggaccgccatgggtgttctgttgcacggtgacgctgctattgccggccagggcgttgtc
tacgaatgtcttggattccactccctgcctggctattccactggcggtaccattcacctg
gttgtgaacaaccagatcggtttcaccaccgatcctcgttttgctcgctcgaccgcctat
tgcacagacattgccaaggccattgacgcacctgtcttccacgtcaacgctgatgatgtc
gaggccgtgaactacatgtgccagcttgccgctgattggcgtgccgagttccaacaggat
gttatcatcgacctcgtctgctaccgcaagcacggccacaacgagaccgaccagccctcg
ttcacccagccgctcatgtacaagaagatccagtccaaggacagccagcttgaaacctac
atcaagaagctcattgaggacggcaccttcaccaaggaggatattgaggagcacaagaag
tgggtgtggggaatgctggaggacagcttctccaagtccaaggaataccagcctacctcc
aaggagtggactacttcggcctggaacgggttcaagtcccccaaggagctcgccaccgag
gtgcttccgcacaaccctactggtgtcgacaagcagaccctgcagcacatcggtgaggtt
atcggctcggcacctgaaaccttcaacctgcaccgcaacctgaagcgtattctcaccaat
cgcaccaagaccgttgtcgagggcaagaacattgactggtcgactgccgaggctttggcc
tttggttcgctggtcactgagggtcaccatgtgcgtgtctctggtcaggatgttgagcgt
ggtaccttctcgcagcgccacgccgtcttccacgaccaggagaccgaggacacatacacc
cccctccagaacgtcagcaaggaccaggccaagtttgtcatctccaactcgtccctcagc
gagtttggcgtgctcggttttgagtacggttactctcttacgtcacccaatgccttggtc
atgtgggaggcccagtttggtgactttgccaacaatgcccagtgtgtgattgaccagttc
atcgcctcgggtgaggtcaagtggatgcagcgcactggtcttgtcatgtcgctgccccac
ggttacgacggtcaaggtcccgagcactcttccggccgtctcgagaggtacctccagctt
tgtaacgaggacccccgtgacttccctactggcgagaagctcatgcgccagcatcaagac
tgcaacatgcagatcgcatacatgactacccctgccaacctgttccacattctccgtcgc
cagatgacgagacaattcaggaagccattgatcatcttcttctccaaggctctcctgaga
caccctctggcgcgttccaacatcgaggacttcactggtgactctcagttccagtggatt
atccccgaccctgctcaccagaccggcgagatcaagtccaacgaggagattgaccgtgtc
attctgtgcactggtcaggtctacaccgccctccacaagcaccgcgccgacaaccagatt
gacaacgtcgccatcactcgtgttgagcagctccaccccttcccttgggatgcgctccgt
gagaacctcgaccagtaccccaacgccaagaccattgtctgggctcaggaggagccgctc
aacgctggtgcctggagctacacacagcccaggattgagactctgttgaaccagactcaa
caccacgaccgtaagcacgtgatgtatgctggtcgccaccccagcgcctcggtcgccacg
ggattgaagtcggcacacgtcaaggaggagaaggagctgctggagatggccttcagcgtc
aagcaggacaagctgaagggcgagtag

DBGET integrated database retrieval system