KEGG   Magnetospirillum gryphiswaldense MSR-1: MSR1_00350Help
Entry
MSR1_00350        CDS       T05662                                 

Gene name
tuf_1
Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
mgry  Magnetospirillum gryphiswaldense MSR-1
Brite
KEGG Orthology (KO) [BR:mgry00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mgry03012]
    MSR1_00350 (tuf_1)
   03029 Mitochondrial biogenesis [BR:mgry03029]
    MSR1_00350 (tuf_1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgry04147]
    MSR1_00350 (tuf_1)
Translation factors [BR:mgry03012]
 Eukaryotic Type
  Elongation factors
   MSR1_00350 (tuf_1)
 Prokaryotic Type
   MSR1_00350 (tuf_1)
Mitochondrial biogenesis [BR:mgry03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MSR1_00350 (tuf_1)
Exosome [BR:mgry04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MSR1_00350 (tuf_1)
  Exosomal proteins of breast cancer cells
   MSR1_00350 (tuf_1)
  Exosomal proteins of colorectal cancer cells
   MSR1_00350 (tuf_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: AVM72562
LinkDB All DBs
Position
35645..36835
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLARQVGVPALVVFMNKCDMVDDPELLDLVELEVRELLSSYDFPGDDIPIVRGSALCALE
DKQPEIGRDAILALMAEVDKYIPQPERPKDKPFLMPIEDVFSISGRGTVVTGRVERGVVK
VGEEVEIVGIKPTVKTTCTGVEMFRKLLDQGEAGDNIGALLRGVKREDVERGQVLAAPGS
ITPHTKFTAEAYILNKEEGGRHTPFFTNYRPQFYFRTTDVTGMVYLPEGTEMVMPGDNVS
MTVQLIAPIAMDEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggcaaaattcgagcgtaataagcctcactgcaatatcggcaccatcggtcac
gtcgaccatggcaagacctcgctgaccgctgccatcaccaaggtgttggccgaaaccggt
ggcgccaccttcaccgcctacgaccagatcgacaaggcgccggaagagaaggcccgtggc
atcaccatctcgaccgctcacgtcgagtacgagaccgccaaccgccactacgcccacgtc
gattgccccggccacgctgactatgtgaagaacatgatcaccggtgcggcgcagatggac
ggcggcattctggtggtgtcggccgccgacggcccgatgccccagacccgcgagcacatc
ctgctggcccgtcaggtcggcgtgccggccctggtggtgttcatgaacaagtgcgacatg
gtcgacgatccggaactgctggatctggtcgagctggaagtgcgcgagctcttgagcagc
tatgatttccccggcgacgatattccgatcgtccgtggttcggccctgtgcgccctggaa
gacaagcagccggaaatcggccgcgacgccatcctggccctgatggccgaagtcgacaag
tacatcccgcagccggaacgtccgaaggacaagccgttcctgatgccgatcgaagacgtg
ttctcgatctcgggccgtggcaccgtggtgaccggtcgcgtcgagcgcggcgtcgtcaag
gtgggtgaagaagtcgagatcgtcggtatcaagccgaccgtcaagaccacctgcaccggc
gttgaaatgttccgcaagctgctcgatcagggtgaggccggcgacaacatcggcgccctg
ctgcgcggcgtgaagcgtgaagacgtggaacgcggtcaagttctggccgctccgggttcg
atcaccccgcacaccaagttcaccgccgaggcctacatcctcaacaaggaagaaggcggt
cgtcacaccccgttcttcaccaattatcgtccgcagttctacttccgcaccaccgacgtc
accggcatggtttacctgccggaaggcaccgaaatggtgatgccgggcgataacgtgtcg
atgaccgtccagctgatcgccccgatcgccatggacgaaggtctgcgcttcgccatccgt
gaaggcggtcgtaccgtcggcgccggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system