KEGG   Magnetospirillum gryphiswaldense MSR-1: MSR1_10380Help
Entry
MSR1_10380        CDS       T05662                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mgry  Magnetospirillum gryphiswaldense MSR-1
Brite
Enzymes [BR:mgry01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MSR1_10380 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AVM73537
LinkDB All DBs
Position
complement(1026705..1027301)
Genome map
AA seq 198 aa AA seqDB search
MAFELPPLPYDKTALEPHISAQTLDFHHGKHHNAYVTNLNNLVKDTDLAAKSLEEIIAIA
AKDLPAKQGVFNNAAQVWNHTFFWNCMKQGGGGKPTGTVLAKIEAAFGSYEKFAEEFKNA
AVTQFGSGWAWLVEENGALKITKTANADLPLAHGQKALLTVDVWEHAYYLDFQNRRPDFV
QTFLDKLVNWDFVAKNLG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgagcttcccccgcttccctatgacaagaccgctctggaaccccatatctcg
gcccagacgctggacttccaccatggcaagcatcacaacgcctatgtgaccaacctgaac
aatctggtgaaggacaccgatctggcggccaagtcgctggaagagatcatcgccatcgcc
gccaaggatctgccggccaagcagggcgtgttcaacaacgccgcccaggtgtggaaccat
accttcttctggaactgcatgaagcagggcggcggcggcaagcccaccggcaccgtgctg
gccaagatcgaggccgctttcggttcctacgaaaagttcgccgaggaattcaagaacgcc
gccgtgacccagttcggctcgggctgggcctggctggtggaagaaaacggcgcgctcaag
atcaccaagaccgccaatgccgatctgcccctggcccacggccagaaggcgctgttgacg
gtggacgtgtgggaacacgcctattacctggatttccagaaccgccgccccgatttcgtc
cagaccttcctggacaagctggtgaactgggatttcgtcgccaagaacctgggctga

DBGET integrated database retrieval system