KEGG   Magnetospirillum gryphiswaldense MSR-1: MSR1_39590Help
Entry
MSR1_39590        CDS       T05662                                 

Definition
(GenBank) ribonuclease BN/unknown domain fusion protein
  KO
K07058  membrane protein
Organism
mgry  Magnetospirillum gryphiswaldense MSR-1
Brite
KEGG Orthology (KO) [BR:mgry00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    MSR1_39590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB C166
Motif
Other DBs
NCBI-ProteinID: AVM76412
LinkDB All DBs
Position
complement(4133284..4134507)
Genome map
AA seq 407 aa AA seqDB search
MEARATAWQVWEFLRFAVRRGRDDGVSRMAGSLAFTSLLSLVPLFAIALAMLAAFPAFDS
VRQDLVSWSFRTFAPTIGDVVQLQINRFIDNAGRLSAVGILSLVITAIMLLVTIEGTMNA
IFRVAKARSPLSKLLVYWTALTLGPLLMGAALSLQGYVTAWSRWSVGKALTPVLALPLPT
TLTILAFAVMFAAVPNRRVAVRDALWGALAAALLFAALRWGFGLYITSSRTYASLYGAVA
VLPVFLLWTYLSWLAILVGAEITAALPEWRSGQHLGSGPSRPGRRLALALEILDVLYARA
RQGSGGASRRELLARTSANEREIMRLLVQLHAAGFTAPTIRRKVVLTRDLDVTTLADLIN
ALDLDLDLDASTALAPWRATVDGLIQQVQSQSRAILTVKLRDILAGG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggaagcccgggccacggcatggcaggtgtgggaatttctgcgtttcgccgtccggcgc
ggacgcgacgacggcgtttcacgcatggccgggtcgttggccttcacctcgctgttgtcg
ttggtgcccctgttcgccatcgctttggccatgttggccgcctttcccgccttcgattcg
gtgcgccaggatctggtgagctggtcgttccgcactttcgcgccgaccatcggcgacgtg
gtgcagttgcagatcaaccgcttcatcgacaatgccggacggctgtcggcggtgggcatc
ctgtcgctggtcatcaccgccatcatgctgctggtgaccatcgaaggcaccatgaacgcc
atcttccgcgtcgccaaggcgcgctcgcccctgtccaagctgctggtctattggaccgcc
ctgaccctggggccgctgctgatgggcgcggccctgtcgctgcaaggctatgtcaccgcc
tggtcgcgctggtcggtgggcaaggcgttgaccccggtgctggccctgcccttgcccacc
accctgaccatcttggccttcgccgtcatgttcgccgccgtgcccaaccgccgggtggcg
gtgcgcgacgccctgtggggggccttggccgccgccttgctgttcgcggcacttcgctgg
ggcttcggcctctacatcacctcgtcgcgcacctatgccagcctgtatggggcggtggcg
gtgctgccggtcttcctgctgtggacctatctgtcctggctggccatcctggtcggggcc
gagatcaccgccgccctgcccgaatggcgcagcggccagcatctcggcagcgggccgtcg
cgccccggacgacgcctggccctggccctggaaattctggatgttctttatgcccgcgcc
cgtcagggcagcggcggcgccagccggcgcgagttgctggcgcggacctcggccaacgaa
cgggaaatcatgcggctgctggtgcagttgcacgccgccggcttcaccgcgccgaccatc
cgccgcaaggtggtgctgacccgcgacctcgacgtcaccaccctggccgatctgatcaat
gccctggacctggatctcgacctcgatgcctcgaccgccctggcgccgtggcgcgccacg
gtggacgggctgatccaacaggtgcaaagccaaagtcgggcgatcctgacggtcaagctg
cgcgatatcctggccggcggatag

DBGET integrated database retrieval system