KEGG   Magnetospirillum gryphiswaldense MSR-1: MSR1_39600Help
Entry
MSR1_39600        CDS       T05662                                 

Gene name
fabI_2
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mgry  Magnetospirillum gryphiswaldense MSR-1
Pathway
mgry00061  Fatty acid biosynthesis
mgry00780  Biotin metabolism
mgry01100  Metabolic pathways
mgry01130  Biosynthesis of antibiotics
mgry01212  Fatty acid metabolism
Module
mgry_M00083  Fatty acid biosynthesis, elongation
mgry_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:mgry00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MSR1_39600 (fabI_2)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MSR1_39600 (fabI_2)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    MSR1_39600 (fabI_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mgry01004]
    MSR1_39600 (fabI_2)
Enzymes [BR:mgry01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     MSR1_39600 (fabI_2)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     MSR1_39600 (fabI_2)
Lipid biosynthesis proteins [BR:mgry01004]
 Fatty acid synthase
  Component type
   MSR1_39600 (fabI_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AVM76413
UniProt: V6F985
LinkDB All DBs
Position
4134607..4135425
Genome map
AA seq 272 aa AA seqDB search
MTAPTPLMAGKKGLIMGVANDRSIAWGIAQAARAQGAELAFTFQGEALEKRVRPLAESVG
SDIVLPCDVSDEASIDAVFDTLKAKWGKLDFVVHAIGYSDKEQLRGRYADTTLDNFLKTM
HISVFSFTSVARRAADMMPDGGSLLTLTYYGAERVMPHYNVMGVAKSALEASVRYLAVDL
GKQNIRVNSLSAGPIKTLAASGIGDFRYILKWNEYNSPLKRNVTLEDIGGSGLYLLSDLS
SGVSGECHHVDCGYHVVGMKAVDAPDITVSKD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcccactccgttgatggccggcaaaaagggcttgatcatgggcgtcgccaac
gaccgctccatcgcctggggcatcgcccaggccgcccgtgcccagggggccgaactggcc
ttcaccttccagggcgaggcgctggaaaagcgcgtgcgtcccctggccgaatcggtgggg
tcggacatcgtcctgccctgcgacgtgtcggacgaggcgtccatcgacgcggtcttcgac
accttgaaggccaagtggggcaagctggatttcgtcgtccacgccatcggctattccgac
aaggaacagctgcgcggtcgttacgccgacaccaccttggacaatttcctgaagaccatg
cacatctcggtcttctcgttcacctcggtcgcccgtcgtgccgccgacatgatgcccgat
ggcggttcgctgctgaccctgacctattacggcgccgagcgggtgatgccgcactacaac
gtcatgggcgtggccaagtcggcgctggaagcaagcgtgcgttatttggccgtcgatctg
ggcaagcagaacatccgcgtcaattccctgtccgccggtccgatcaagaccctggcggcg
tcgggcatcggcgatttccgctatatcctcaagtggaacgaatacaacagcccgttgaag
cgcaacgtcaccttggaagacatcggcggttcgggcctgtacctgctgtccgatctgtca
tcgggcgtgtcgggcgaatgccatcacgtcgattgcggctatcacgtcgtcggcatgaag
gcggtggacgcccccgacatcaccgtttccaaggactga

DBGET integrated database retrieval system