KEGG   Mycoplasma gallisepticum NC95_13295-2-2P: HFMG95NCA_5046Help
Entry
HFMG95NCA_5046    CDS       T02201                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mgs  Mycoplasma gallisepticum NC95_13295-2-2P
Pathway
mgs00240  Pyrimidine metabolism
mgs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    HFMG95NCA_5046 (tdk)
Enzymes [BR:mgs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HFMG95NCA_5046 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AFP76992
LinkDB All DBs
Position
859732..860406
Genome map
AA seq 224 aa AA seqDB search
MAKKNAMTTTNGWIEAICGPMFAGKTDELIRKIKRYEYADVKSLVFSPATDTRSAQEIIN
SRDGRRIGSIKIKKAFEIYDYVLLHKPQLVGIDEVQFFDDSIVEVIQTLADNQINVIVAG
LDRDFRGEPFGPIPKILGIAESVIRLTAICSECGAEASRSQRLIDNQPADYNCETILIGD
TESYAPRCRHHHKVPNRPINDQTKNFKRALKNNFDKIVEQSSKD
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaagaacgcaatgaccaccactaatggttgaatcgaagcaatttgtggtccg
atgtttgctggtaaaacagatgaactaattcgcaagattaaacgttatgagtatgctgat
gtaaagtcgttggtcttttcaccagcaactgatactcgttcagctcaagagattatcaac
tctcgagatgggcgtagaattggttcaataaagatcaaaaaagcatttgaaatctatgat
tatgttttattacataaaccacaattagttggaattgacgaagtgcaattctttgatgat
tcaattgttgaagtcatccaaacattagctgataaccaaattaacgtaattgtggctggt
ttagaccgtgattttagaggtgaaccttttggtccaattcctaagattttaggaattgca
gaatcagtaatccgcttaaccgcaatctgttctgagtgtggtgctgaagctagtcgaagt
caacgtttaattgataaccaaccagctgactacaattgcgaaacgattcttattggtgac
actgaatcatacgcgccaagatgtcgtcatcaccataaagtgcctaaccggccaattaac
gaccaaaccaagaacttcaaacgtgcactaaaaaataattttgataaaatagtagagcaa
tcttcaaaagattaa

DBGET integrated database retrieval system