KEGG   Mycoplasma genitalium M6320: CM1_00715Help
Entry
CM1_00715         CDS       T02211                                 

Definition
(GenBank) tryptophanyl-tRNA synthetase
  KO
K01867  tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
mgx  Mycoplasma genitalium M6320
Pathway
mgx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mgx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CM1_00715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mgx01007]
    CM1_00715
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mgx03016]
    CM1_00715
Enzymes [BR:mgx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     CM1_00715
Amino acid related enzymes [BR:mgx01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   CM1_00715
Transfer RNA biogenesis [BR:mgx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CM1_00715
 Prokaryotic type
    CM1_00715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1b PAC4
Motif
Other DBs
NCBI-ProteinID: AFQ03933
LinkDB All DBs
Position
complement(153928..154971)
Genome map
AA seq 347 aa AA seqDB search
MIKRTITGIQASGRQHLGNFLGVMQGLKQLQSQYQLFLFVADLHAITVDFEPTMLKDNNL
QLVKTLLALGLDYGKVNLFLQSDLMEHTMLGYLMLTQSNLGELQRMTQFKTKKLAQKRNS
NNTITIPTGLLTYPVLMAADILLYQPDIVPVGNDQKQHLELTNDLAKRVAKKFKLKLKLP
VFIENKDTNRIMDLSNPLKKMSKSNPDQNGVIYLDDSKETIIKKVRKATTDSFNKIRFAK
KTQPGVTNLLVILTALLKEEVNHNLSKKIGSDLVKYYQNKSYLDLKNDLSSAVINVIESL
KFKKAQITDEMVLKVLNDGKNQAKKVADETLKMFYKAFGLTSNQLFD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgataaagcgcacaattacagggattcaagcttctggaagacaacacctaggtaacttt
cttggcgtaatgcaaggtttaaaacaactccaaagtcaataccaactgtttttatttgtt
gctgatcttcatgctattactgttgattttgaaccaacaatgctcaaagataacaacttg
caacttgttaaaactttattagcactaggacttgattatggaaaagtgaacttattttta
caaagtgatctgatggaacataccatgttaggttatctaatgctgacacaaagtaatcta
ggtgaattacaaagaatgacccaatttaaaacaaagaaattagcgcaaaaaagaaatagt
aataacaccattactatcccaactggtttgttaacttacccagtgttaatggctgctgat
atcttgctttatcaacctgatattgttccagttggtaatgatcagaagcagcacttggaa
ttaaccaatgatttagctaaacgtgtagcaaaaaaatttaagttaaaactgaaattacct
gtatttatagaaaacaaagataccaacaggatcatggatctatcaaatcctttaaaaaag
atgtccaaatcaaatcctgatcaaaatggtgttatctatctggatgatagtaaagaaaca
atcatcaaaaaagtgcgcaaagccacaactgatagttttaataagattcgttttgctaaa
aaaacccaacctggtgttactaatttacttgttattttaactgcacttttaaaagaagaa
gttaaccataatttaagtaaaaaaatcggctctgatcttgttaaatattatcagaataaa
agttatttagatttaaagaatgacctcagtagtgctgttattaatgtcatagaatcactt
aaatttaaaaaagcacaaattactgatgaaatggtattaaaagtcctaaatgatggtaaa
aaccaagctaaaaaagttgctgatgaaacattaaaaatgttttataaagcatttggttta
acatctaatcagctttttgattaa

DBGET integrated database retrieval system