KEGG   Mycoplasma genitalium M6320: CM1_01300Help
Entry
CM1_01300         CDS       T02211                                 

Definition
(GenBank) HMW2 cytadherence accessory protein
Organism
mgx  Mycoplasma genitalium M6320
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFQ04039
LinkDB All DBs
Position
258989..264406
Genome map
AA seq 1805 aa AA seqDB search
MKPFDKKPSLQPIYDIGFDDGYLQSEYEKNRSKTDVDKIENQLLKEIKSLEDELKNLKGL
KNQAEDNPELDKKINHLEVDLNRLVNEYKNFQFQKNHMVDKVSELDNLTRFYKNELTRLQ
QENADFLNSKYANLANFQANYHNKLNDFHRLIENQNQTINRLNQKINGNQNLIDNNVALL
QNPNITVEKKNYLLNVIDQLYNELDQLENQKRLLSIEYENTYRELVSADNELQNVYENID
QNQIQFKHQYQTYRDELSQLERKIQLTKQELVDKESALRVKIDDADFYINARLAELDDVA
KQLSFQDGITKQNAQHVEDKLVALNKEKDRLNTQKEAFFNLRQSALIDINKLQQENELFA
KHLEHQQNEFEQKQSDSLLKLETEYKALQHKINEFKNESATKSEELLNQERELFEKRREI
DTLLTQASLEYEHQRESSQLLKDKQNEVKQHFQNLEYAKKELDKERNLLDQQKKVDSEAI
FQLKEKVAQERKELEELYLVKKQKQDQKENELLFFEKQLKQHQADFENELEAKQQELFEA
KHALERSFIKLEDKEKDLNTKAQQIANEFSQLKTDKSKSADFELMLQNEYENLQQEKQKL
FQERTYFERNAAVLSNRLQQKREELLQQKETLDQLTKSFEQERLINQREHKELVASVEKQ
KEILGKKLQDFSQTSLNASKNLAEREMAIKFKEKEIEATEKQLLNDVNNAEVIQADLAQL
NQSLNQERSELQNAKQRIADFHNDSLKKLNEYELSLQKRLQELQTLEANQKQHSYQNQAY
FEGELDKLNREKQAFLNLRKKQTMEVDAIKQRLSDKHQALNMQQAELDRKTHELNNAFLN
HDADQKSLQDQLATVKETQKLIDLERSALLEKQREFAENVAGFKRHWSNKTSQLQKIYEL
TKKQESEQTQKETELKIAFSDLQKDYQVFELQKDQEFRQIEAKQRELDKLAEKNNQVKLE
LDNRFQALQNQKQDTVQAQLELEREQHQLNLEQTAFNQANESLLKQREQLTKKIQAFHYE
LKKRNQFLALKGKRLFAKEQDQQRKDQEINWRFKQFEKEYTDFDEAKKRELEELEKIRRS
LSQSNVELERKREKLATDFTNLNKVQHNTQINRDQLNSQIRQFLLERKNFQRFSNEANAK
KAFLIKRLRSFASNLKLQKEALAIQKLEFDKRDEQQKKELQQATLQLEQFKFEKQNFDIE
KQRQLVAIKTQCEKLSDEKKALNQKLVELKNLSQTYLANKNKAEYSQQQLQQKYTNLLDL
KENLERTKDQLDKKHRSIFARLTKFANDLRFEKKQLLKAQRIVDDKNRLLKENERNLHFL
SNETERKRAVLEDQISYFEKQRKQATDAILASHKEVKKKEGELQKLLVELETRKTKLNND
FAKFSRQREEFENQRLKLLELQKTLQTQTNSNNFKTKAIQEIENSYKRGMEELNFQKKEF
DKNKSRLYEYFRKMRDEIERKESQVKLVLKETQRKANLLEAQANKLNIEKNTIDFKEKEL
KAFKDKVDQDIDSTNKQRKELNELLNENKLLQQSLIERERAINSKDSLLNKKIETIKRQL
HDKEMRVLRLVDRMKLAEQKYQTEINRLRTQTFDSEKQDIKNFFPPLFKINGNDMAFPYL
YPWLYPQQKQDDNTLQIRQLFEQQLQFMQQRYENELNELRRQRNLLEKKLDQIQLESQLN
NKQSEFSKVESMMEKLLEKTESRLNDFDQKINYLTKKVNQHNTYQPSSYQPTPSYQDSDK
QQLLFRIQELEKQNLFQQQFQPAPAVVQQPTSFAAPNITKQQQIAQLNAEINNIKRLIAQ
KAASK
NT seq 5418 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccatttgataaaaaaccttcgctgcaaccaatttatgacattggttttgatgat
ggttatctccaaagtgagtatgaaaaaaatcgttctaaaaccgatgttgataagatcgaa
aaccagcttttaaaagagattaaaagcctggaagatgaacttaaaaaccttaagggcttg
aagaatcaagcagaagataatcctgaacttgataaaaagattaaccacttggaagttgat
ctaaaccgtttggttaatgaatataaaaacttccagttccaaaagaaccacatggttgat
aaggttagtgaacttgataacttaacccgtttttataagaatgaactaacccgcttacaa
caagaaaacgctgattttctcaactccaagtatgctaatttagctaacttccaagctaac
taccacaataaactaaatgattttcaccgcttaatagaaaatcaaaaccaaaccattaac
cgcttaaaccaaaagattaatggtaaccaaaatctgattgataataacgttgctttactg
caaaaccccaacatcacagttgaaaaaaagaactacttactaaatgttattgatcaactt
tacaatgagcttgatcaacttgagaatcaaaaaagattattaagtattgagtatgaaaat
acctatagagagttagttagtgcagataatgaactgcaaaatgtttatgaaaacatcgat
caaaatcagatccagtttaaacaccaataccaaacttatagagatgagttaagtcaactt
gagcgcaagatccagctcaccaaacaagagttagttgataaagaatcagcactaagagta
aagatagatgatgctgatttttacattaatgcccgtttagctgaacttgatgatgtagct
aaacaacttagctttcaagatggtattaccaagcaaaatgctcaacatgttgaggataag
ttagttgctttaaacaaagaaaaagaccgtttaaatacccaaaaagaggccttttttaac
ttaagacaatctgctttaattgatatcaataaactccagcaggaaaatgaactgtttgct
aagcacttagaacaccagcaaaatgagtttgaacaaaaacagtctgatagcctcttaaag
cttgaaactgaatataaggctttacaacacaagattaatgaatttaaaaatgaaagtgcc
actaagagcgaggaacttttaaaccaagaacgggaactatttgaaaaacgcagggaaatt
gacacgcttttaacccaagcatctttggaatatgaacaccaacgtgagtcaagtcaacta
ctcaaagataagcagaatgaagtaaaacaacacttccaaaacttagagtatgctaaaaag
gagctagacaaagaaagaaacctcttagatcaacaaaaaaaagttgatagtgaagcaatc
tttcaactcaaagaaaaggttgctcaagaacgtaaggagcttgaagaactataccttgtt
aaaaaacaaaaacaagatcagaaggaaaatgaactgttgttttttgaaaagcagttaaaa
caacaccaagcagattttgaaaatgaattggaagctaaacaacaggagttgtttgaagct
aaacatgcattggaacgttcctttatcaaacttgaagataaagaaaaagatcttaacact
aaagcacaacagattgccaatgagttttcccaactaaaaactgataagtcaaagagtgct
gattttgaactaatgttgcaaaatgagtatgaaaacttgcaacaagaaaaacaaaagtta
ttccaagaacgtacttactttgaaaggaatgctgcggttttatcaaaccggttacaacaa
aaacgtgaggagttattacaacaaaaagaaacgcttgatcagcttacaaaaagctttgag
caagaacggttaatcaaccaaagggaacacaaggagttggttgcatcagttgaaaaacaa
aaggagatattgggcaaaaaactccaagatttttcccaaacttcactgaacgcttctaaa
aatttagctgaacgggagatggcaatcaagtttaaagaaaaggagatagaagcaactgaa
aagcaactgttaaatgatgttaataatgctgaagttatccaagcagacttagcacaactc
aaccaatcacttaaccaagaacgcagtgaattgcaaaacgccaaacaaaggattgctgat
tttcacaatgattcactaaaaaaactcaatgagtatgaacttagcttacaaaaacggttg
caagaattacaaacccttgaggctaaccaaaaacaacattcatatcaaaatcaagcttac
tttgaaggtgaacttgataaacttaacagagaaaaacaagcttttttgaacttacgtaag
aaacaaactatggaggttgatgctattaaacaaaggttgagtgataaacatcaagcttta
aatatgcaacaagcagagctagatagaaaaacccatgagttaaataatgcttttttaaac
catgatgcggatcaaaagagtctacaggaccaactagcaactgttaaagagacccaaaaa
ctaattgatttagaacgtagtgcactgcttgaaaagcaacgtgagtttgctgaaaatgtt
gctggttttaagcgccattggtctaataaaactagtcaactccaaaagatttatgaactg
accaaaaaacaggaaagtgagcaaacccaaaaggaaacagaactaaagattgcttttagt
gatctacaaaaagactatcaggtttttgaactccaaaaggaccaagaatttagacaaatt
gaagctaagcaacgtgaacttgacaagttagctgaaaaaaataatcaggtcaaactagaa
cttgataacaggtttcaagcgctgcaaaaccaaaagcaagacacagtacaagctcagcta
gaactggaacgtgaacaacaccagttaaaccttgagcaaactgctttcaaccaagctaat
gaatcacttttaaaacaacgtgaacaactcaccaaaaagatccaagctttccactatgag
ttgaaaaagcgtaaccaattcttagctttaaaagggaaaaggttgtttgcaaaagagcaa
gatcaacaacgcaaagatcaggagatcaactgacgctttaaacagtttgaaaaggaatat
actgattttgatgaagctaagaaaagggaacttgaagagcttgaaaagatcagaagaagt
ttaagtcaaagcaacgttgaattagagagaaaaagagaaaaactggctactgatttcact
aatttaaataaggttcaacacaacacccaaattaaccgtgatcaacttaacagtcagatc
agacagttcttattagaacgcaaaaacttccaacgctttagtaatgaagctaatgctaaa
aaagcctttttaattaagcgcttaagaagctttgcatccaatctaaaactccaaaaagaa
gcgttagcaatccaaaaactagagtttgataagcgtgatgaacaacagaaaaaagagtta
cagcaagctactttacaactagaacagttcaagtttgaaaagcaaaactttgacattgaa
aaacaacgccaactagttgctattaaaactcagtgtgaaaaacttagtgatgaaaaaaag
gcactaaaccaaaagctagttgaactaaaaaacttatcccaaacctatcttgctaataag
aataaggctgaatactcccagcaacaactccaacagaaatacaccaatttacttgatctg
aaggaaaacttagagagaaccaaagatcaattagataaaaaacatcgttctatcttcgct
agattaactaagtttgcaaatgacttacgttttgaaaaaaagcaactgttaaaagcacag
cgcatagttgatgataaaaaccgtcttttgaaagaaaatgaacgtaacctccatttcctt
tccaatgaaacagaacgaaaacgagcagttctcgaagatcaaatttcttactttgaaaaa
caacgtaaacaagctactgatgcgatcctagcatcacataaagaagttaaaaagaaggaa
ggtgaactgcaaaagttactggttgaattagaaacaagaaaaaccaaactcaacaatgat
tttgcaaaattctcaagacaacgtgaagagtttgaaaaccaacgcttaaagctcttggaa
ctgcaaaaaaccctgcaaacccaaactaattccaacaactttaaaaccaaagcaatccaa
gagattgaaaacagttataaaagggggatggaagaacttaacttccaaaagaaggagttt
gataagaataaatcacgcttatatgaatactttagaaagatgcgtgatgagattgaaaga
aaggaaagtcaggttaagttagttttaaaagagacccaaaggaaagccaacctcttagaa
gcacaagccaacaaacttaacattgaaaaaaacactattgactttaaagaaaaagagtta
aaagcctttaaagataaggttgatcaagacattgattcaaccaataaacaacgcaaggag
ttaaatgagcttttaaatgaaaacaagttattacaacaatcactaatcgaaagagaaagg
gctattaattccaaagattcacttctaaataagaagatagaaacgattaaacgccaactc
catgataaggagatgcgggtgttgcgcttggttgatagaatgaaattagcagaacagaaa
taccaaacagaaatcaaccgcttaagaacccaaactttcgattctgaaaaacaagacatt
aaaaacttcttcccaccgttatttaaaattaacggtaatgatatggcctttccttacttg
tacccctgactatatcctcaacaaaagcaagatgataatactctgcaaattcgtcagctt
tttgaacagcagctgcagttcatgcaacaacgctatgaaaatgagttaaatgaattgcgt
agacaacgtaatttacttgagaaaaaacttgatcaaatccaactagaatcccaacttaat
aataagcaaagtgagtttagtaaggtggaatcaatgatggaaaaactacttgaaaaaact
gagagtaggttaaatgattttgatcagaaaattaactatctcaccaagaaagttaaccaa
cacaacacctatcaaccaagttcctatcaaccaactccttcttatcaagacagtgataaa
caacagttgttatttagaatccaagaactggaaaaacaaaacttattccaacaacaattt
caacctgcaccagctgttgtccaacaacctactagttttgcagcccctaacatcaccaaa
caacagcaaattgcccaacttaatgctgaaattaacaacattaaaaggttgattgcccaa
aaagcagcaagtaaataa

DBGET integrated database retrieval system