KEGG   Magnetospirillum gryphiswaldense MSR-1 v2: MGMSRv2__0022Help
Entry
MGMSRv2__0022     CDS       T02960                                 

Gene name
tufB
Definition
(GenBank) Elongation factor Tu (EF-Tu)
  KO
K02358  elongation factor Tu
Organism
mgy  Magnetospirillum gryphiswaldense MSR-1 v2
Brite
KEGG Orthology (KO) [BR:mgy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mgy03012]
    MGMSRv2__0022 (tufB)
   03029 Mitochondrial biogenesis [BR:mgy03029]
    MGMSRv2__0022 (tufB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgy04147]
    MGMSRv2__0022 (tufB)
Translation factors [BR:mgy03012]
 Eukaryotic Type
  Elongation factors
   MGMSRv2__0022 (tufB)
 Prokaryotic Type
   MGMSRv2__0022 (tufB)
Mitochondrial biogenesis [BR:mgy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MGMSRv2__0022 (tufB)
Exosome [BR:mgy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MGMSRv2__0022 (tufB)
  Exosomal proteins of breast cancer cells
   MGMSRv2__0022 (tufB)
  Exosomal proteins of colorectal cancer cells
   MGMSRv2__0022 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: CDK97237
UniProt: V6EVW5
LinkDB All DBs
Position
22870..24060
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLARQVGVPALVVFMNKCDMVDDPELLDLVELEVRELLSSYDFPGDDIPIVRGSALCALE
DKQPEIGRDAILALMAEVDKYIPQPERPKDKPFLMPIEDVFSISGRGTVVTGRVERGVVK
VGEEVEIVGIKPTVKTTCTGVEMFRKLLDQGEAGDNIGALLRGVKREDVERGQVLAAPGS
ITPHTKFTAEAYILNKEEGGRHTPFFTNYRPQFYFRTTDVTGMVYLPEGTEMVMPGDNVS
MTVQLIAPIAMDEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggcaaaattcgagcgtaataagcctcactgcaatatcggcaccatcggtcac
gtcgaccatggcaagacctcgctgaccgctgccatcaccaaggtgttggccgaaaccggt
ggcgccaccttcaccgcctacgaccagatcgacaaggcgccggaagagaaggcccgtggc
atcaccatctcgaccgctcacgtcgagtacgagaccgccaaccgccactacgcccacgtc
gattgccccggccacgctgactatgtgaagaacatgatcaccggtgcggcgcagatggac
ggcggcattctggtggtgtcggccgccgacggcccgatgccccagacccgcgagcacatc
ctgctggcccgtcaggtcggcgtgccggccctggtggtgttcatgaacaagtgcgacatg
gtcgacgatccggaactgctggatctggtcgagctggaagtgcgcgagctcttgagcagc
tatgatttccccggcgacgatattccgatcgtccgtggttcggccctgtgcgccctggaa
gacaagcagccggaaatcggccgcgacgccatcctggccctgatggccgaagtcgacaag
tacatcccgcagccggaacgtccgaaggacaagccgttcctgatgccgatcgaagacgtg
ttctcgatctcgggccgtggcaccgtggtgaccggtcgcgtcgagcgcggcgtcgtcaag
gtgggtgaagaagtcgagatcgtcggtatcaagccgaccgtcaagaccacctgcaccggc
gtggaaatgttccgcaagctgctcgatcagggtgaggccggcgacaacatcggcgccctg
ctgcgcggcgtgaagcgtgaagacgtggaacgcggtcaggttctggccgctccgggttcg
atcaccccgcacaccaagttcaccgccgaggcctacatcctcaacaaggaagaaggcggt
cgtcacaccccgttcttcaccaattatcgcccgcagttctacttccgcaccaccgacgtc
accggcatggtttacctgccggaaggcaccgaaatggtgatgccgggcgataacgtgtcg
atgaccgtccagttgatcgccccgatcgccatggacgaaggcctgcgcttcgccatccgt
gaaggcggtcgtaccgtcggcgccggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system