KEGG   Magnetospirillum gryphiswaldense: MGMSRv2__0184Help
Entry
MGMSRv2__0184     CDS       T02960                                 

Gene name
nrtB
Definition
(GenBank) Nitrate transport permease protein (nrtB)
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
mgy  Magnetospirillum gryphiswaldense
Pathway
mgy00910  Nitrogen metabolism
mgy02010  ABC transporters
Module
mgy_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:mgy00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MGMSRv2__0184 (nrtB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MGMSRv2__0184 (nrtB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mgy02000]
    MGMSRv2__0184 (nrtB)
Transporters [BR:mgy02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    MGMSRv2__0184 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: CDK97399
UniProt: V6EW37
LinkDB All DBs
Position
complement(217195..218052)
Genome map
AA seq 285 aa AA seqDB search
MTMVTTPTQVKEAAVAAPLSRPAAPSELKKKLRHVAAVTLPPLVGLVVLLGLWELACRQA
GAMLPPPSKVLTDTKELILDPFFDNGGTDKGLFWHLAASLKRVAMGFSLSAIIGITLGMI
IGQSKLAMRALDPIFQVLRTVPPLAWLPISLAAFKAADPSAIFVIFITSVWPIILNTAVG
VRNIPQDYRNVAAVLRLSPLEFFAKIAMPASVPYIFTGLKIGIGLSWLAIVAAEMLIGGV
GIGFFIWDAWNSSLMSEIILALVYVGLVGFALDRLITLIGKKVAG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggtcaccacccccacccaagtcaaggaggcggctgtcgccgcccccctgtcg
cgccccgccgcccccagcgagttgaagaagaagctgcgccacgtggccgccgtgaccttg
ccgcccttggtcggtctggtcgtcctgctcggcctgtgggaactggcctgccggcaggcg
ggcgccatgctgccgccgccgtccaaggtgctgaccgacaccaaggaactgatcctcgat
ccgttcttcgacaatggcggcaccgacaagggcctgttctggcatctggccgcaagcctc
aagcgcgtggccatgggcttctcgttgtcggcgatcatcggcatcacgctcggcatgatc
atcggccagagcaagctggccatgcgggcgctcgaccccatcttccaggtgctgcgcacg
gtgccgcccttggcctggctgcccatttccctggccgccttcaaggccgccgatccctcg
gccatcttcgtcatcttcatcacctcggtgtggccgatcatcctcaacaccgccgtcggc
gtccgcaacatcccccaagattaccgcaacgtcgccgccgtgctgcggctgtcgccgttg
gaattcttcgccaagatcgccatgccggcctcggtcccctacatcttcaccggcctgaaa
atcggcatcggcctgtcgtggctggccatcgtcgccgccgagatgctgatcggtggcgtc
ggtatcggcttcttcatctgggacgcctggaactcgtcgctgatgagcgaaatcatcctc
gccctggtctatgtcggcctggtcggcttcgccctcgaccgcctgatcaccctgatcggc
aagaaggtcgcgggctga

DBGET integrated database retrieval system