KEGG   Magnetospirillum gryphiswaldense MSR-1 v2: MGMSRv2__0757Help
Entry
MGMSRv2__0757     CDS       T02960                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mgy  Magnetospirillum gryphiswaldense MSR-1 v2
Brite
KEGG Orthology (KO) [BR:mgy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MGMSRv2__0757 (ahpF)
Enzymes [BR:mgy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MGMSRv2__0757 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like NAD_binding_7 FAD_oxidored DAO FAD_binding_3 K_oxygenase Glutaredoxin AlaDh_PNT_C Thi4 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: CDK97972
UniProt: V6EXW1
LinkDB All DBs
Position
791196..792770
Genome map
AA seq 524 aa AA seqDB search
MLDDTMKTQLKAYLEMVEQPIQLVASLDDGAKSQELRELLAEIAALSAKITVVDGADART
PSFAITRPGSDVSVRFAGIPLGHEFTSLVLALLQVSGRAPKVEADVIEQIKALDGEYSFQ
TYFSLSCQNCPDLVQALNLMSVVNPRIKHVAIDGALFQAEVEALKVMAVPAVFLNGQPFA
QGRMGLEEILAKLDTGAAARDAAKINAKDAFEVLVVGGGPAGAASAIYAARKGIRTGVVA
ERFGGQVLDTMAIENFISVSHTEGPKLGAALEQHVKEYDVDIMNVQRAEKLIPASSLGGL
IQVQLASGATLQARSVIVATGARWRSMNVPGETEYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQAKLRSLPNVAVITSALTTEVHGDGA
KVVGLSYKDRTTEQVHRVELEGIFVQIGLVPNSEWLKGTMALSARGEIEVDARGQTSVPG
VFAAGDVTTVPYKQIIIAMGEGAKAALSAFDHLIRLPAATEAAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgatacgatgaagacccagttgaaggcctatctcgagatggtcgagcaaccc
atccagttggttgcttccctcgacgatggcgccaagtcccaggaattgcgggaattgctg
gccgaaatcgcggccctttccgccaaaatcaccgtcgtcgacggtgccgacgcgcgcacg
ccgtccttcgccatcacccgccccgggtccgacgtgtcggtgcgtttcgccggcattccc
ctgggccatgaattcacttcgctggtcctggccctgttgcaggtgtcgggccgcgccccc
aaggtcgaagccgacgtgatcgagcagatcaaggcgctggatggcgagtacagcttccag
acctatttctcgctgtcgtgccagaactgccccgatctggtgcaggcgctcaacctgatg
agcgtggtcaatccgcgcatcaagcatgtggccattgacggtgccctgttccaggccgag
gtcgaggcgctgaaggtgatggcggtgcctgctgtcttcctcaacggccagcccttcgcc
caaggccgcatgggcctcgaggaaatcctggccaagctcgataccggcgccgccgcccgc
gatgccgccaagatcaacgccaaggacgctttcgaggtgctggtggtcggcggtggtccg
gctggcgccgcctcggccatctatgccgcccgcaagggcatccgtaccggcgtggtggcc
gaacgtttcggcggtcaggtgctggacaccatggccatcgagaatttcatctcggtcagc
cataccgaaggccccaagctgggcgcggcgctggaacagcacgtcaaggaatacgacgtc
gacatcatgaacgtgcagcgggcggaaaagctgatcccggcctccagcctcggcggtctg
atccaggtgcaactggccagcggcgccacccttcaggcccgttcggtcatcgtcgccacc
ggtgcgcgctggcgctccatgaacgtgccgggcgagaccgagtaccgcaacaagggcgtg
gcctattgcccccattgtgatggtccgttgttcaagggcaagcgggtggcggtgatcggc
ggtggcaattccggtgtcgaagcggccatcgatctggccggtatcgtcgcccatgtgacc
ttgatcgaattcgactcgcaattgcgcgccgatgcggtgttgcaggccaagctgcgcagc
ctgcccaatgtggcggtgatcacctcggccctgaccaccgaggtgcatggcgacggtgcc
aaggtggtggggctgtcctacaaggaccgcactaccgagcaggtgcatcgggtcgagttg
gaaggcatcttcgtccagatcggtctggtgcccaatagcgaatggctgaagggcaccatg
gcgctgagtgcgcgcggcgagatcgaagtggatgcccgtggccagacttcggtgcccggc
gtgttcgccgccggcgacgtcaccacggtgccctacaagcagatcatcatcgccatgggc
gagggcgccaaggcggcgctgtcggcctttgaccacctgatccgcctgccggccgccacc
gaagcggcggcttga

DBGET integrated database retrieval system