KEGG   Magnetospirillum gryphiswaldense MSR-1 v2: MGMSRv2__2500Help
Entry
MGMSRv2__2500     CDS       T02960                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mgy  Magnetospirillum gryphiswaldense MSR-1 v2
Pathway
mgy00473  D-Alanine metabolism
mgy00550  Peptidoglycan biosynthesis
mgy01100  Metabolic pathways
mgy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mgy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MGMSRv2__2500 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MGMSRv2__2500 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MGMSRv2__2500 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mgy01011]
    MGMSRv2__2500 (ddl)
Enzymes [BR:mgy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MGMSRv2__2500 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:mgy01011]
 Precursor biosynthesis
  Amino acid ligase
   MGMSRv2__2500 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 B12-binding Peripla_BP_6 GARS_A ATP-grasp NAD_binding_8 RimK
Motif
Other DBs
NCBI-ProteinID: CDK99715
UniProt: V6F2G2
LinkDB All DBs
Position
2608900..2609820
Genome map
AA seq 306 aa AA seqDB search
MSRRVTVLMGGASAERDVSLRSGAAAAAALEQAGFTVATIDAGRDVTALAQAITASRPDV
VFNALHGRFGEDGCVQGLLNLLGIPYTHSGLLASAAAMDKAFSRQVFQQAGIPVAHGVVV
EKTDGGADPMKRPFVVKPINEGSSVGVYVMKPGDNRAPLADWPFESDRVLVEEFVPGREL
TVAVMGDRALGCLEITSERGFYDYDAKYAPGGSKHIMPAPIPAEDYAEACRLAVEAHRVL
GCRGVSRADLRYDDTKPGQKPRLIVLEVNTQPGMTATSLVPDIASYCGISFPELVRWMVE
QAECDG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccgcgtcaccgtgctgatgggcggagcctccgccgaacgcgacgtgtcgttg
cgctcgggcgccgccgccgccgccgctctggaacaggccggcttcaccgttgccaccatc
gatgccgggcgcgatgtgacggccttggcccaggccatcaccgccagccgtcccgacgtg
gtgttcaacgcgctgcatggccgtttcggcgaggatggctgcgtccagggtctgctcaat
ctgctgggcatcccctatacccattccggcctgttggcctcggccgccgccatggacaag
gcgttttcgcgccaagtgttccagcaggccggcatcccggtggcccatggcgtggtggtg
gaaaagaccgatggcggcgccgaccccatgaagcgtccgttcgtggtcaagcccatcaac
gagggctcgtccgtcggcgtctatgtgatgaagccgggcgacaaccgcgcccccctggcc
gattggccgttcgagtccgaccgcgtgctggtggaagaattcgtccccgggcgcgagctg
accgtggcggtgatgggcgaccgcgccctgggctgtctggaaatcacctcggaacgcggc
ttctacgattatgacgccaaatatgcgccgggcggctcgaagcacatcatgcccgccccc
atcccggcggaagattacgccgaagcctgccggctggcggtggaagcccatcgcgtgctg
ggctgccgcggcgtgtcgcgcgccgatctgcgttacgacgacaccaagcccgggcaaaag
ccgcgtctgatcgtgttggaagtcaacacccagccggggatgaccgccacctcgctggtc
cccgacatcgcgtcttattgcggcatcagcttccccgagttggtgcgctggatggtcgag
caagcggagtgtgacggatga

DBGET integrated database retrieval system