KEGG   Mycobacterium haemophilum: B586_01190Help
Entry
B586_01190        CDS       T04111                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mhad  Mycobacterium haemophilum
Pathway
mhad00010  Glycolysis / Gluconeogenesis
mhad00053  Ascorbate and aldarate metabolism
mhad00071  Fatty acid degradation
mhad00280  Valine, leucine and isoleucine degradation
mhad00310  Lysine degradation
mhad00330  Arginine and proline metabolism
mhad00340  Histidine metabolism
mhad00380  Tryptophan metabolism
mhad00410  beta-Alanine metabolism
mhad00561  Glycerolipid metabolism
mhad00620  Pyruvate metabolism
mhad00625  Chloroalkane and chloroalkene degradation
mhad00903  Limonene and pinene degradation
mhad01100  Metabolic pathways
mhad01110  Biosynthesis of secondary metabolites
mhad01120  Microbial metabolism in diverse environments
mhad01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mhad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B586_01190
   00053 Ascorbate and aldarate metabolism
    B586_01190
   00620 Pyruvate metabolism
    B586_01190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B586_01190
   00561 Glycerolipid metabolism
    B586_01190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B586_01190
   00310 Lysine degradation
    B586_01190
   00330 Arginine and proline metabolism
    B586_01190
   00340 Histidine metabolism
    B586_01190
   00380 Tryptophan metabolism
    B586_01190
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B586_01190
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B586_01190
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B586_01190
Enzymes [BR:mhad01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     B586_01190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKN18362
LinkDB All DBs
Position
complement(291114..292580)
Genome map
AA seq 488 aa AA seqDB search
MTDSQKTEYDKLFIGGNWTRPSTSQVIKVHCPATGEYVGKVPMAAAADVDAAVAAARAAF
DHGPWPSTPPAQRAAVIAAAVKLMGDRKNLFTTLLAAETGQPPTIIETMHWMGSMGAMSF
FAGAADKITWTETRTGSYGQTIVSREPVGVVGAIVAWNVPLFLAVNKLGPALLAGCTVVL
KPAAETPLTANALAEVLAEAGLPEGVLSVVPGGVETGQALTSNPDIDMFTFTGSSAVGKE
VGKRAAELLKPCTLELGGKSAAIILEDVDLAAAIPMLVFSGVMNAGQGCVNQTRILAPRS
RYDEIVDAVSTFVQALPVGLPSDPAVQVGPLISEKQRTRVEGYIAKGIAEGARLVCGGGR
PEGLDNGFFVQPTVFADVDNKMTIAQEEIFGPVLSIIGYDTEEEAIAIANDSVYGLAGSV
WTTNVPKGIKISEQIRTGTYGINWYAFDPGCPFGGYKNSGIGRENGPEGVEHFTQQKSVL
MPMGYTVS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacagccagaagacggagtacgacaaactctttatcggcggcaactggacgcga
ccgtcgacctcccaagtcatcaaggtgcactgcccggccaccggtgagtatgtcggcaag
gtgccgatggcggctgccgccgatgttgacgccgcggtcgcggcggcccgcgcagcgttc
gaccacggtccctggccgtcgacgccgccggcgcagcgcgcggccgtgatcgccgcggcg
gtcaagttaatgggggatcgcaagaacctgttcaccacgctgctggccgctgagaccggt
cagccacccaccatcatcgagacgatgcattggatgggctcgatgggagcgatgagcttc
ttcgccggtgctgcggacaaaatcacgtggaccgagacccgcaccggctcatacgggcag
accatcgtcagccgggaaccggtcggagtggtcggcgctatcgtcgcatggaacgtgccg
ctgttcctggcggtgaacaagctgggcccggcgctgctggccggctgcaccgtggtactc
aagccggctgccgaaaccccattgaccgcaaacgctttggccgaggtcctcgccgaggcg
ggcctaccggagggtgtgctctcggtggtgccgggcggcgtcgagaccggacaagccctg
acgtcgaacccggacatcgacatgtttaccttcaccggcagttccgccgtcggtaaagag
gtcggtaagcgggccgccgaactgctcaagccgtgcaccttggagctcggcggtaagtcg
gcggccatcatcctcgaggatgtcgacctggccgccgcgattcccatgttggtgttctcc
ggggtgatgaacgcggggcagggctgcgtgaatcagacccgcatcttggctccgcgctct
cggtacgacgaaatcgtggacgcagtaagcactttcgtgcaagcgctgccggtcgggctg
ccgtctgacccggccgtccaagtcgggccactgatctcggagaagcagcggacccgggtc
gagggctatatcgccaagggcatcgcggagggcgctcggctggtgtgcggtggtggccgt
cccgagggcctcgacaacggattttttgtgcagcccacggtattcgccgacgtcgacaac
aagatgacgatcgcccaggaggagatctttgggccggtgctaagcatcatcggttatgac
accgaggaggaagcgatcgcgatcgccaatgactcggtgtatgggctggccggcagcgtg
tggactaccaacgtgccgaagggcatcaagatctcggagcagatccgcaccgggacgtac
ggaatcaattggtatgccttcgatcccggctgtccattcggcggctacaagaactccggt
atcgggcgggagaacgggcccgaaggggtcgagcacttcactcaacaaaagagcgtgctg
atgccgatgggctacacggtcagctga

DBGET integrated database retrieval system