KEGG   Mycobacterium haemophilum: B586_03565Help
Entry
B586_03565        CDS       T04111                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mhad  Mycobacterium haemophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase LZ_Tnp_IS481 PNKP_ligase
Motif
Other DBs
NCBI-ProteinID: AKN15846
LinkDB All DBs
Position
3970802..3971878
Genome map
AA seq 358 aa AA seqDB search
MDLPVMPPVSPMLAKSVRSIPANASYEPKWDGFRSICFRDGDQVELGSRNERPMTRYFPE
LVAAATAELPKRCVIDGEIVIATDHGLDFEALQQRIHPADSRVRMLAERTPASFIAFDLL
ALGDDDYTERPFSERRSALVDALAVSAADSAASIHVTPATTDRATAQRWFAQFEGAGLDG
LVAKPLTITYQPDKRVMFKIKHERTADCVVAGYRVHKSDTDAIGSLLLGLYQDDGQLASV
GVIGAFPMAERRQLFTELQPLVTGFDGHPWNWAAHKAGERTPRKNETSRWNTGKDLSFVP
LLPERVVEVRYDHMEGRRFRHTAQFSRWRPDRDPRSCTYDQLEQPLTFSLSDIVPGLA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggacttacccgtgatgccaccggtctcgccaatgctggccaagtcggttcgatcgatc
ccagcaaatgcgtcgtatgagcccaaatgggatggatttaggtccatatgctttcgcgac
ggcgatcaagttgagcttggcagccgcaacgagcgaccgatgacccgttacttccccgag
ttggtcgcggcggccaccgcagagttgcccaaacgctgcgtgattgatggtgaaattgtc
atcgctaccgaccacggcttggacttcgaggcactacaacagcgcatccacccagccgat
tcgcgggtgcgaatgctcgccgagcggacgccggcttccttcatcgcgttcgacctgctc
gccctcggcgacgatgactacaccgagcgaccgttcagcgagcggcgctccgctctcgtt
gacgcattagctgtttcggcggccgattcggccgcatcgatccacgtcacgccggcaacc
accgatcgggcgacagcacagcgatggttcgcgcagttcgagggggcgggcctggacggc
cttgtcgccaaaccgctgacgatcacctatcaacccgacaaacgcgtcatgttcaagatc
aagcacgaacggactgccgactgtgtggtcgccggctaccgagtacacaagtccgacacc
gacgcgatcggctcgctgctgctcgggctctaccaggatgacggccaactcgcatcggtc
ggggtgatcggcgctttcccgatggccgagcggcggcagctgttcaccgaactgcagcca
ctggtcaccggctttgacggccacccgtggaactgggccgcccacaaagccggcgaacgc
acgccgcgcaagaacgaaacatcccgctggaacaccggcaaggacctctcatttgtgcct
ctgctacccgagcgggtggtcgaggtccgctacgaccacatggaaggacgacggttccgc
cataccgcccagttcagccgttggcgccccgatcgcgacccccggtcgtgcacctacgat
cagctcgaacaaccactcaccttcagcctcagcgacatcgtgcccggcctcgcctaa

DBGET integrated database retrieval system