KEGG   Mycobacterium haemophilum: B586_15815Help
Entry
B586_15815        CDS       T04111                                 

Definition
(GenBank) glycogen synthase
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
mhad  Mycobacterium haemophilum
Pathway
mhad00500  Starch and sucrose metabolism
mhad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B586_15815
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mhad01003]
    B586_15815
Enzymes [BR:mhad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     B586_15815
Glycosyltransferases [BR:mhad01003]
 Polysaccharide
  Storage polysaccharide
   B586_15815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_transf_5 Glyco_trans_4_4 Glyco_trans_1_2 Glycogen_syn NmrA
Motif
Other DBs
NCBI-ProteinID: AKN18794
LinkDB All DBs
Position
complement(1360108..1361352)
Genome map
AA seq 414 aa AA seqDB search
MKILMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRRPSGTDPRTHPSSDEINEG
VRVIAAAQDPHEFTFSDDMMAWTLAMGHAMIRAGLSLTRPGSNRPWRPDVVHAHDWLVAH
PAIALAQFYDVPTVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSASMGD
EITELFGPGLAEITVICNGIDPARWPFAARRARTGPAELLYVGRLEYEKGVHDVIAALPR
IRRSYPGTTLTVAGEGTQQDWLIDQARKYKVLKATRFVGHLDHNELLAALHRADAAVLPS
HYEPFGLAALEAAAAGTPLVTSNIGGLGEAVINGQTGVSCPPRDVAGLAAAVCAVLDDPD
AAQRRARAARERLTSDFDWQTVAQQTAQVYLAAKRRERQPQPRLPIIEHALPDR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcctgatggtgtcctgggagtatccgccggtggtgatcggcgggctcggccgc
cacgtccatcacctgtcgacggcgctggccgccgccggccacgacgtggtcgtgctgtct
cgccgcccctcgggcaccgatccccgtacgcatccgtcctccgatgagatcaacgagggt
gtgcgggtgatcgcggccgcacaggatccgcacgagttcaccttcagcgacgacatgatg
gcctggaccctggcgatgggccacgcgatgatccgcgccggcctgtccctgaccagacct
ggcagcaaccgcccctggcgtcccgatgtcgtacacgcacacgattggctggtggcacat
ccagccatcgcgctcgcccaattctatgatgtgccaactgtttccacgattcacgcgacg
gaagccggccggcattccggctgggtatctggagcactcagccgtcaggtgcacgccgtc
gagtcgtggctggtgcgtgaatccgattcgctgatcacatgttcggcatcgatgggcgac
gaaatcaccgaattgtttggtcccggcctggccgagatcacggtgatatgcaatggcatt
gacccggcacgctggccgttcgcggcccgccgtgcgcgcaccggaccggccgaactgctc
tacgtgggaaggctggaatatgagaaaggtgtgcacgacgtcatcgcggcactgccgcgg
atcagacgcagctaccccggcaccacgttgaccgtcgctggagaaggcacccagcaggac
tggctcatcgaccaggcccgtaaatacaaggtactcaaagcaacccggttcgtcgggcac
ctcgaccacaacgaactgctggcggcgctgcatcgggccgacgccgcggtgctgccgagc
cactacgagccgttcgggctggctgcgctggaggccgccgcagccggcacgccactagtg
acctcgaacatcggcggcctgggcgaggcggtaattaacgggcagaccggggtttcgtgt
ccgccccgcgatgtcgcggggctggccgcggcggtgtgcgcagtgctcgacgatccagac
gccgcgcagcggcgcgcgcgggctgcccgggagcgtctcacctccgacttcgattggcaa
acggtagctcagcagaccgcacaggtgtatctggcggccaagcgccgcgaacgacaaccg
caaccccggctgcccatcatcgaacacgcattgccggatcgctag

DBGET integrated database retrieval system