KEGG   Mycobacterium haemophilum: B586_18245Help
Entry
B586_18245        CDS       T04111                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mhad  Mycobacterium haemophilum
Pathway
mhad00473  D-Alanine metabolism
mhad01100  Metabolic pathways
mhad01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mhad00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    B586_18245
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    B586_18245
Enzymes [BR:mhad01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     B586_18245
Peptidoglycan biosynthesis and degradation proteins [BR:mhad01011]
 Precursor biosynthesis
  Racemase
   B586_18245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AKN18072
LinkDB All DBs
Position
851306..852481
Genome map
AA seq 391 aa AA seqDB search
MVGVAVTPISLRPGVLAEAVVDLGAIDHNVRVLREHAGSAQLMVVLKADAYGHGATQVAL
AALAAGAAELGVATVDEALALRADGISAPVLAWLHPPGTDFGPALAADVQIAVSSVRQLD
EVLDAVRRTGRTATVTVKADTGLNRNGVAPDQYPAMLTALQRAVAEDAVRLRGLMSHLAY
ADQPDNPSNDVQGRRFAALLAQARQQGVRFEVAHLSNSSATMSRPDLAYDLVRPGIAVYG
LSPVPALGDMGLIPAMTVKCAVALVKSIRAGEGVSYGHAWIAQRDTNVALLPIGYADGVF
RSLGGRLDVLINGKRRPGVGRICMDQFVVDLGPGPIDVAEGDEAILFGPGASGEPTAQDW
ADLLGTIHYEVVTSPRGRITRTYREAHTVDR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcgtggctgtgacaccgatatccctgaggccgggcgtgctggccgaggctgtg
gtggacctgggagctattgaccacaacgtgcgagtgctgcgcgagcacgccggcagcgca
cagctgatggttgtccttaaggccgacgcctatggccatggggccactcaggtcgcgctc
gccgccttggcggccggtgcggccgagctgggtgtggccaccgtcgacgaagcgctggca
ttgcgcgcggacggcatcagcgcaccggtgctggcctggctgcatccacccgggaccgac
ttcgggcctgcgctggccgccgacgtgcagatcgcggtgtcttcggtgcgccagctcgac
gaggtgctggatgcggtgcgtcggaccggccgtacggcgacggtgaccgtcaaggccgac
accgggctgaaccgcaacggcgtcgcgcccgaccaatacccggcgatgctgaccgcgttg
cagcgggctgtcgccgaggacgccgtccggctgcgcgggttgatgtcgcatctggcttac
gctgaccagcccgacaatcccagcaatgacgttcagggcaggcggttcgccgccttgctc
gcccaggcgcgccagcagggggtgcggttcgaggtggcgcacctgtcgaattcatcggcc
acgatgtctcgtcccgacctggcctacgacctggtccggcccggcatcgcggtgtacggc
ctgagtccggtgcctgctctcggtgatatgggactaatacccgcgatgacggtgaaatgc
gctgtcgcgctggtgaagtcgattcgcgctggcgagggcgtgtcgtacggacacgcttgg
attgcgcagcgtgacaccaatgtagcgctgctgccgatcggatacgcggatggcgtgttc
cggtcgctgggcgggcggctggacgtgctgatcaacggcaagcgtcggcctggcgtcgga
cggatctgtatggaccagttcgtcgtcgacctgggcccggggccgatcgatgtagccgaa
ggcgacgaggccatcttgttcggacccggcgccagcggcgaacccaccgcgcaagattgg
gccgatctgcttggcaccatccactatgaagtggtcaccagtccacgcgggcggatcacc
agaacgtaccgcgaggctcacaccgttgacaggtga

DBGET integrated database retrieval system