KEGG   Mannheimia haemolytica D153: F382_00480Help
Entry
F382_00480        CDS       T02746                                 

Definition
(GenBank) sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
mhae  Mannheimia haemolytica D153
Pathway
mhae00511  Other glycan degradation
mhae00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mhae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    F382_00480
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    F382_00480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:mhae02042]
    F382_00480
Enzymes [BR:mhae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     F382_00480
Bacterial toxins [BR:mhae02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   F382_00480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_3 BNR_2 BNR Autotransporter GA ERp29 UBN_AB
Motif
Other DBs
NCBI-ProteinID: AGQ24570
LinkDB All DBs
Position
complement(95321..97696)
Genome map
AA seq 791 aa AA seqDB search
MRKINQLIISPYFFLSILSASANSDFWKSDLNFNLTNITKRVGVDNFTTPVAGEPWAGIG
PNGEAAGTAPLYYSRIPAMQVTEDNKLVVMFDLRWNRAYDQDRIDPGIAISSDGGHTWTK
KTAWSFDRTNHPARRSMDPTLLHNPIDNSLYVMHGTWSMSDQQWYGGRVPHFNSGSWAAT
IYKSTDGGLNWEKNTEFSKFSNLDVFSKVTKNGKPTLGFLGGVGSGIVMQDGTLVFPIQT
AHQNGIATTIMYSKDNGKTWEMPEIDNPVAPNQSSLENMVFELEPGKLVMTGRGNSRWAY
SSTDMGKTWELFTPTNGLLPTSSQPTQGSSIYVTLPNGRKVLLISKPDGKNDGWKRGDIT
LWMLDAKDPSHKHKVHIIRPGSGNAAGAGYSSLAYKEGNLFVAFENDGDISVKNLTEHIA
EMEAKAIEWGLPDELTPALDKINALPYLNKAQKETLVEKMRRANDTAIAQSFVINKEMYN
LKNNSDELDKLAKNITKALPSQQNIYQRALAYVNKVTNTADTTYLNYNGIMDTYANLYES
YLALNTKLDFTRYIQKARKFNEYNTDILYRSFDNFFAHYDTGVKHNNLSLGLNTKLSENL
RGGLFFEYSNKNRNSVQIGARAKYEMDNHQLSGFLRYRGVKHKDMLARNNSVDGYLNYAY
RIQLDDKLSISPSVGAYVSRSSRSLIDEDLAINSRTVYASDVGLNIHYKLNDIDAYIRPS
IGFVNGDITLSQSNDMTNTYKIKDKSNVYSVTTGLKKRFANGVALGADFKLHRYGSQTTE
SNFGLNVSYNW
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatcaatcagttaatcatatccccatactttttcctaagtattttatctgct
tccgctaactctgatttttggaaaagcgaccttaattttaatctcacaaatattaccaag
cgtgtcggagtcgataactttaccactccagtagctggcgagccttgggctggtattggt
ccaaatggtgaagctgcaggtactgcgccattatattatagccgtattccagctatgcaa
gttaccgaagataacaaattagttgttatgtttgatttacgctggaatcgtgcgtatgac
caagatcgtattgatcctggtattgcgatttcttccgatggtggccatacttggacgaag
aaaaccgcttggtcttttgatagaactaatcacccagcacgccgttcaatggatccaacg
ctattacataatcctattgataatagtttatatgtaatgcacggaacttggtctatgtcg
gatcaacaatggtatggtgggcgtgttcctcactttaatagtggcagctgggcagctacc
atttataaatctactgatggtggtttaaattgggagaaaaatactgagtttagtaaattc
agcaatttagacgtattttctaaagtcaccaaaaatggaaaacctaccttaggcttttta
ggcggggtcggatctggaattgtaatgcaagatggtacgttggttttcccaattcaaacc
gcacatcaaaatggtattgcgaccactattatgtattctaaggataatgggaaaacttgg
gaaatgccagaaattgacaacccagttgcaccgaaccaaagttctttagaaaatatggtg
tttgaactcgaaccgggtaagctagtgatgactggacgaggaaacagtcgctgggcatac
tcttctactgatatgggtaagacctgggaattatttactccaactaatggattattacca
actagctcacaaccaactcaaggctcttctatctatgtaacactaccaaatggtcgaaaa
gtgctactaatctctaaaccagatggaaagaatgatgggtggaaaaggggtgatattaca
ctttggatgctagatgcaaaagatccatcgcacaaacacaaggtgcatattattcgtcca
ggttcaggtaatgccgctggtgctggttattcctctttagcctataaagaagggaattta
tttgttgcttttgaaaacgatggtgatatttcagtaaaaaatttaactgaacatattgct
gaaatggaagcaaaagctatcgaatggggattaccagatgaacttactcctgctttggat
aaaatcaatgcactgccttatctcaataaagctcaaaaagagacgctagtcgaaaaaatg
cgtcgtgctaatgatactgcgattgcacaatcttttgtgattaacaaagaaatgtataat
ctgaaaaacaatagtgatgagctggataaattggcaaaaaatattactaaagcactgccg
tctcaacagaatatttatcaaagagccttagcctatgtgaataaagtcaccaatacagcg
gataccacttatttaaattataatggtattatggatacctatgctaatttatatgaaagc
tatttggctttaaatactaaattagacttcactcgctacatccaaaaagcgagaaagttc
aatgaatataacactgatattttatatcgtagctttgataatttctttgcccattacgac
acaggtgtaaaacacaataatctatccttaggcttgaatacaaaattaagtgagaattta
cgtggtggcttattctttgaatacagtaataaaaatcgtaatagcgtacaaattggtgca
agagctaaatatgaaatggataatcaccaactttctggcttcttacgctatcgtggcgta
aaacataaagatatgctagcacgtaataacagtgttgatggctacctaaattatgcttat
cgtattcaattagatgataaattaagcattagcccatcagttggtgcttacgtttcacgt
tcttctcgctcattaatagatgaagatcttgcgattaatagccgcacggtctatgcaagt
gatgtaggattgaatatccattataagctaaatgatattgatgcttatattcgtccaagt
ataggctttgtcaatggtgatataactttatctcaatctaatgatatgacaaacacatac
aaaataaaggataaaagtaacgtgtattctgtcacgacagggttgaaaaaacgctttgca
aatggtgtggcattaggggctgatttcaaattacatcgttatggttctcaaactactgaa
agtaatttcggtctaaatgtaagttataactggtaa

DBGET integrated database retrieval system