KEGG   Mannheimia haemolytica D153: F382_01235Help
Entry
F382_01235        CDS       T02746                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mhae  Mannheimia haemolytica D153
Pathway
mhae00240  Pyrimidine metabolism
mhae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhae00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    F382_01235
Enzymes [BR:mhae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     F382_01235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14
Motif
Other DBs
NCBI-ProteinID: AGQ24328
LinkDB All DBs
Position
complement(212835..213416)
Genome map
AA seq 193 aa AA seqDB search
MAKLYFYYSSMNAGKSTTLLQSSYNYQERGMNTLVYTAAIDDRFGVGKVNSRIGISQEAN
LFTADTNLFAEIKALHSNKALHCILIDEAQFLTKTQVYQLSDVVDKLKIPVLCYGLRTDF
QAELFEGSKYLLAWADELEELKTICDCGKKAHFVVRLNEKGEAIKDGEQIQIGGNDRYLS
VCRYHYKQKLGKL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttttactactcctcaatgaatgcaggcaaatctactactctgctt
caatcttcttataattaccaagaacgtggaatgaacactttagtttataccgccgctatt
gatgaccgtttcggtgtggggaaagtcaactctcgtatcggtatttcacaagaagccaat
ttatttaccgctgataccaatctatttgcggaaattaaggcattacactcaaacaaagcg
ttacactgtatcttgattgatgaggctcagtttttaactaaaacacaggtttatcaatta
agtgatgtggtcgataaactcaaaattccggtgctttgctacgggctacgcaccgatttc
caagctgaattatttgaaggtagcaaatatttgttggcttgggcagatgagctggaagaa
ctcaaaaccatctgtgattgtggcaaaaaagcccattttgtcgttcgattaaatgaaaaa
ggcgaagccattaaagacggtgaacaaatacaaatcggcggcaatgatagatatctctct
gtttgccgttatcattacaaacaaaagttaggtaagctataa

DBGET integrated database retrieval system