KEGG   Mannheimia haemolytica D153: F382_06090Help
Entry
F382_06090        CDS       T02746                                 

Definition
(GenBank) amino acid ABC transporter substrate-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
mhae  Mannheimia haemolytica D153
Pathway
mhae02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mhae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    F382_06090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mhae02000]
    F382_06090
   02035 Bacterial motility proteins [BR:mhae02035]
    F382_06090
Transporters [BR:mhae02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    F382_06090
Bacterial motility proteins [BR:mhae02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    F382_06090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 InPase MacB_PCD
Motif
Other DBs
NCBI-ProteinID: AGQ25553
LinkDB All DBs
Position
1179843..1180616
Genome map
AA seq 257 aa AA seqDB search
MLKKLSIAALALTLSVSAFAKESLLERINNKGTITVGTEGTYAPYTYHDASGKLTGYDVE
VTRAVAEKLDVKVEFKETQWDAMLAGLKGERFDLVANQVALTSPERRATFDKSESYSWDG
AALLVREDETKIKTPADVKGVKTAQTLSSNYGEIARENGADIVPIDGMAQGLLLIQQKRA
DATFNSHLSLLDYLKKNPNSGLKIVWEKEEKVGAGLIANKGNDEALAKISKAIVELREDG
TLKKLGEQFFGKDISVQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaaattatcaattgctgcattagctcttaccctttctgtttctgcatttgct
aaagagagcctacttgagcgtataaacaacaaagggactattactgtgggtacggaagga
acttatgccccttacacctatcacgatgcgagcggtaaattaaccggttacgatgtagaa
gtaacccgtgcggtggctgaaaaattagacgtaaaagtggaatttaaagagacacaatgg
gacgctatgttagccggtttaaaaggtgagcgttttgacttagtggcaaaccaagtggct
ttaaccagcccggaacgtcgagcgacatttgataaatccgaatcttacagctgggacggt
gccgccttattagtgcgtgaagatgaaactaaaatcaaaacccctgctgatgtaaaaggc
gtgaaaactgcccaaaccttgagctcaaactatggcgagattgcccgtgaaaacggtgca
gacatcgtgccaattgacggtatggctcaaggcttactgttaattcaacaaaaacgcgcc
gatgcaactttcaatagccacttatcgctattagattacttgaaaaagaacccgaattcc
ggcttaaaaattgtgtgggaaaaagaagaaaaagtgggtgcaggcttaattgcgaataaa
ggcaatgacgaagcattagcgaaaatcagcaaagcaatcgtagaattacgtgaagacggc
acgttaaaaaaattgggcgagcagttcttcggtaaagatattagtgtacaataa

DBGET integrated database retrieval system