KEGG   Mannheimia haemolytica USMARC_2286: N220_05240Help
Entry
N220_05240        CDS       T02758                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
mhal  Mannheimia haemolytica USMARC_2286
Pathway
mhal00061  Fatty acid biosynthesis
mhal00780  Biotin metabolism
mhal01100  Metabolic pathways
mhal01212  Fatty acid metabolism
Module
mhal_M00083  Fatty acid biosynthesis, elongation
mhal_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:mhal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    N220_05240
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    N220_05240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mhal01004]
    N220_05240
Enzymes [BR:mhal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     N220_05240
Lipid biosynthesis proteins [BR:mhal01004]
 Fatty acid synthase
  Component type
   N220_05240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AGR74786
LinkDB All DBs
Position
complement(1018778..1019236)
Genome map
AA seq 152 aa AA seqDB search
MTTENREPNIIEVTEIMDMLPHRYPFLLVDRVTDYEEGKWLKAIKNVTFNEPCFTGHFPG
APIFPGVLILEAMAQATGVLAVATYGKLSEDELYYFAAIDNARFKRPVVPGDQLQLEVEF
LKEVRGITKFTGKAYVDGKLVCEADLMCARRK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgaaaatcgtgagccaaatattattgaagtaaccgaaattatggatatgtta
ccgcatcgctaccctttcctgttagttgatcgcgtaaccgattatgaagaagggaaatgg
ttaaaagccattaaaaatgtaaccttcaatgaaccttgttttaccgggcattttcctggc
gcaccaatcttcccaggagtattgattctggaagcaatggctcaagcaactggcgtatta
gccgttgccacttatggtaagttaagtgaagacgaactctactattttgccgcaattgac
aatgctcgctttaagcgaccggttgtgccgggcgatcaacttcaacttgaggttgaattt
cttaaagaagtacgtggtattactaaatttaccggtaaagcatacgttgatggcaaatta
gtctgtgaagcagatttaatgtgcgctcgccgtaaataa

DBGET integrated database retrieval system