KEGG   Mannheimia haemolytica USMARC_2286: N220_09580Help
Entry
N220_09580        CDS       T02758                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhal  Mannheimia haemolytica USMARC_2286
Pathway
mhal00010  Glycolysis / Gluconeogenesis
mhal00030  Pentose phosphate pathway
mhal00051  Fructose and mannose metabolism
mhal00052  Galactose metabolism
mhal00680  Methane metabolism
mhal01100  Metabolic pathways
mhal01110  Biosynthesis of secondary metabolites
mhal01120  Microbial metabolism in diverse environments
mhal01130  Biosynthesis of antibiotics
mhal01200  Carbon metabolism
mhal01230  Biosynthesis of amino acids
mhal03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mhal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    N220_09580
   00030 Pentose phosphate pathway
    N220_09580
   00051 Fructose and mannose metabolism
    N220_09580
   00052 Galactose metabolism
    N220_09580
  09102 Energy metabolism
   00680 Methane metabolism
    N220_09580
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    N220_09580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mhal01009]
    N220_09580
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mhal03019]
    N220_09580
Enzymes [BR:mhal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     N220_09580
Protein phosphatases and associated proteins [BR:mhal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     N220_09580
Messenger RNA biogenesis [BR:mhal03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     N220_09580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AGR75540
LinkDB All DBs
Position
1815584..1816558
Genome map
AA seq 324 aa AA seqDB search
MSKKIKKIAVLTSGGDAPGMNAAIRGVVRTALNEGLEVCGIQDGYYGLYHDKVIPLDRRS
VSETINRGGTFLGSARFPDFKRPEVRKHCVETLKKYSIDALVVIGGDGSYMGAKLLTEEF
GYPCIGIPGTIDNDIVGTDYTIGYQTALETALDAIDRLRDTSSSHQRISIVEIMGRHCGD
LTLSAALAGGCEYVIVPEKGLDKDALMRSIEEGFHKGKRHSIIAITELMTDVHALAKEIE
ARFGNETRATVLGHIQRGGSPCAFDRILASRMGVYAVELLLQGFGGHCVGIQNEQLVHHD
IIDAINNMRRPFKEELFEASRKLF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaaatcaaaaaaattgcagtattaaccagtggtggtgatgcaccaggaatg
aacgcggcaatccgtggtgtggttcgtaccgcacttaatgaaggtttagaggtttgtggt
attcaagacggctactatgggctttaccacgataaagtgatcccacttgaccgccgttcc
gtgtctgaaaccatcaaccgaggcggtacattcttaggttctgcccgcttccctgatttt
aaaagaccagaagttcgcaaacattgtgtcgaaaccttaaaaaaatacagcattgatgca
ttagtggttattggtggcgacggttcttatatgggggctaaattattaaccgaagaattt
ggttacccttgtatcggtattccgggtacgattgataacgatattgtgggaacggattac
accatcggctatcaaactgcccttgaaaccgcattagatgcgattgaccgcctgcgtgat
acttcaagttcacaccaacgtatttcgattgtggaaattatgggtcgccactgtggtgat
ttaaccctaagtgctgccctcgccggtggttgcgaatatgtgatcgtaccggaaaaaggc
ttagataaagatgcattaatgcgaagcattgaagaaggtttccacaaaggtaaacgccat
tcaattattgcaattacagaattgatgaccgatgttcacgcattagcgaaagaaattgaa
gcacgtttcggcaatgaaacccgtgcaaccgtattaggtcatattcaacgtggtggttcg
ccttgtgccttcgaccgtattttggcctcccgtatgggcgtctatgcggtggaattatta
ctgcaaggctttggcggtcactgtgtcggtattcaaaacgagcagttggttcaccacgat
attattgatgcgatcaataatatgcgtcgtccgttcaaagaagaattatttgaagcctct
agaaaattattctaa

DBGET integrated database retrieval system