KEGG   Mannheimia haemolytica USMARC_2286: N220_11035Help
Entry
N220_11035        CDS       T02758                                 

Definition
(GenBank) inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
mhal  Mannheimia haemolytica USMARC_2286
Pathway
mhal00521  Streptomycin biosynthesis
mhal00562  Inositol phosphate metabolism
mhal01100  Metabolic pathways
mhal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mhal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    N220_11035
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    N220_11035
Enzymes [BR:mhal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     N220_11035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: AGR75810
LinkDB All DBs
Position
2104646..2105458
Genome map
AA seq 270 aa AA seqDB search
MNPMLNIAIRAARKAGNIIAKGYEQSPQDTQVLQKNTNDYVTEIDKAAEAAIIDVIRKSY
PEHSIVTEESGVLNGSNENVQWVIDPLDGTTNFVKRLPHFAVSIAVRENGRTTVGVVYDP
IRNELFTAVRGEGAKLNEFRLRIDAERRDLKGTVIATGFPFKVIRHRDAHLNMLEGLMNN
GVADFRRTGSAALDLAYVAAGRVDGFFEIGLKPWDFAAGELIAREAGAIVTNFVGGTDYL
KTGNLVVGNGRVVKEILNSIQPTLTEELKA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaatgttaaacattgctattcgtgcggcacgaaaagcaggcaatattattgcc
aaaggctatgaacaatcgcctcaagatacacaagttttacaaaaaaatacgaatgattat
gtgactgaaatcgataaagcagcggaagcggcaattattgatgtgatccgtaaatcttac
cctgaacactcgatcgtgaccgaagagtccggcgtgttaaacggtagcaatgaaaatgta
caatgggtgatcgatccattagatggtacaaccaatttcgtaaaacgcttacctcatttt
gctgtgtcgattgccgtgcgtgaaaacggacgtacaacagtaggggtagtttacgatcct
atccgtaacgagcttttcactgcggtgcgtggcgaaggggctaaattaaacgagttccgt
ttacgcattgatgcagaacgccgtgatttaaaaggcactgtaattgcaaccggttttcct
ttcaaagtcatcagacatcgtgatgcacatttaaatatgcttgaaggcttaatgaataac
ggagtagctgatttccgccgtaccggttctgccgctttagatcttgcctatgttgcagcg
ggtcgtgttgatggtttctttgaaatcggcttaaaaccgtgggatttcgccgccggtgaa
cttattgcccgtgaagccggtgcaattgtgactaactttgttggcggaacagattacttg
aaaacaggtaatctggttgttggtaacggccgtgtggttaaagaaattttaaatagcatt
cagcctactttgaccgaagaactcaaagcttaa

DBGET integrated database retrieval system