KEGG   Mannheimia haemolytica USMARC_2286: N220_12330Help
Entry
N220_12330        CDS       T02758                                 

Gene name
mrcB
Definition
(GenBank) bifunctional glycosyl transferase/transpeptidase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
mhal  Mannheimia haemolytica USMARC_2286
Pathway
mhal00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mhal00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N220_12330 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mhal01003]
    N220_12330 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mhal01011]
    N220_12330 (mrcB)
Enzymes [BR:mhal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     N220_12330 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     N220_12330 (mrcB)
Glycosyltransferases [BR:mhal01003]
 Polysaccharide
  Bacterial polysaccharide
   N220_12330 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:mhal01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   N220_12330 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: AGR76045
LinkDB All DBs
Position
2342290..2344692
Genome map
AA seq 800 aa AA seqDB search
MSDVELNEQSEQEPEQKPKKRNYFLSTLFKIGVIGACSMAFYGIYLDGKIRSKMDGQIWE
LPAEVYARIESIKIEDNLTLEQTKQALLDNGYRQVSQVATPGDFKIEENQLVLLRRAFPF
PETPESQRVLRLTFKQDKLTYIEDLVQGKLIEEFRLDPKLLALLHSDSDEERQALRLQQY
PRLLIESLILTEDRRFYQHDGISPIGIARALITNYQAGRTVQGGSTLTQQLVKNLFLSNE
RSLVRKVNEALMSVILDFRYDKNRILETYLNEIYLGQNGSYQIHGFALASQFYFGRPIQE
ISLDQIALLVGMVKGPSLYNPWRNPQGAVERRNVVLRLLLDHQVINQELYALLSSRPLNI
REKGTIYREQPAFMQALTIDLKNELGEIKSAQLSGTKIFTTLDRKQQRSAEQAVITGLED
LESKNKKVSDLQSAIVVAEYRTGKVRAIVGDRLTQFAGFNRAIQSKRQIGSLVKPSVYAI
ALAQPELFRLNTPIQNKQISIKVGSTYWTPRNYDRSFSGSVMLMDALVRSLNIPTVNIGM
KVGLKKVIAKQKEMGWDNAEIPPYPSTLLGSYSISPYDVTRSYQVIANEGLKTPLTTIEA
IISHNGEMFYQRDSGKVSEQVLPPEAAVQTMYAMQQVVERGTARSLQNDFAKLKLAGKTG
TTNNARDTWFVGIDGEHVTTVWLGKDNNGDTNLTGSSGALYVYKQYLERALPQAYRLPKL
NTMQWVGINSYGSWNCDSGRQIPVWRDKGQRYCTSAGNVVATEKPSVWDALSLKKENIEA
KAEEAEGKQPIPTEEVAPIE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgttgagttaaacgagcagagcgagcaagagcctgagcaaaaaccgaaaaag
cgaaactatttcctttcaaccttattcaaaatcggggtgataggagcttgcagtatggct
ttttacggcatttatttagacggtaaaatccgtagcaaaatggatgggcagatatgggaa
ttaccagctgaggtgtatgctcgtattgaaagcattaaaattgaagacaacttaacgctt
gagcaaaccaaacaagcgttgctggataacggctatcgtcaagtttctcaagttgcgaca
ccaggcgatttcaaaattgaagaaaatcagctggtgttgctacgccgagctttcccgttt
ccagaaacaccggaatcgcaacgagtgcttcgtttaactttcaaacaagataaattaact
tatattgaagatttggtgcagggtaagttgatcgaggagttccgcttggatccgaaatta
ctggcgttactgcattccgatagcgatgaagaacgtcaagcattacgcttacaacaatac
cctcgcttgttaattgagtcactgattttaaccgaagatcgccgcttttatcagcacgat
gggattagcccaatcggtattgcccgtgctttaatcactaactaccaagctggcagaaca
gtgcagggtggcagtaccttaacgcaacagttagtgaaaaacttgttcttaagtaatgaa
agatcgttggtgcgtaaggtaaatgaagcgttaatgtcggtgattttagacttccgttac
gataaaaaccgcattttagaaacctatctcaacgaaatttatttagggcagaacggtagc
taccaaattcacggttttgcattggcaagccaattctattttggtcgtccgatccaagag
attagcttagaccaaattgcgttattggtgggaatggtaaaaggtccatcactgtataac
ccgtggcgaaatccgcaaggtgcggtagagcgacgtaatgtggtgttgcgattattgctg
gatcatcaagtgatcaatcaagaactttacgctctgttaagctcccgcccgcttaatatt
cgtgaaaaaggcacgatttaccgtgagcaacctgcctttatgcaggcattaaccattgat
ttgaaaaatgagttaggcgaaattaagtcagctcaactttccggtactaaaatttttacg
acccttgaccgtaaacagcaacgttcagccgaacaagcagtgattaccggtttggaagat
ctggaaagtaaaaataaaaaagtcagcgatttgcaatcggctattgtcgtggcggaatac
cgcacaggtaaagtgagggcgatagtaggagaccgcttaacccaatttgccggctttaac
cgtgcgattcagtcaaaacgccaaatcggttctttagtcaaaccatcggtttatgcgatt
gccttggcacagcctgaattattccgtttaaatacaccgatccaaaataaacaaatttca
attaaggttggttcaacctactggacaccccgtaactacgaccgcagttttagtggctcg
gtgatgttaatggacgccttagtccgctctctgaatattccaacggtgaatattggtatg
aaagttggcttaaaaaaagtcattgccaaacaaaaagagatgggctgggataatgcggaa
attccgccttacccatcaaccttgctaggttcatattcgatctcgccttacgatgtaacc
cgctcttatcaagtaattgccaacgaagggctgaaaacaccattaaccaccattgaggcg
attatttcgcacaatggcgaaatgttctatcagcgagatagcggcaaagtgagcgagcag
gtgcttccaccggaagctgcggttcaaacaatgtatgcgatgcaacaggttgtggaacga
ggtacggctcgtagcttacaaaacgattttgccaaactgaaattagccggcaaaaccggt
acaaccaataacgctcgagatacttggtttgtgggaattgatggcgaacacgtcacaacc
gtctggctgggtaaagataacaatggggataccaacctcaccggttcaagtggtgcattg
tatgtgtataagcaatatcttgagagagccttgcctcaggcgtatagattaccgaaactt
aatacgatgcaatgggtggggattaatagctatggtagctggaattgcgatagtggcaga
caaattccagtttggcgagataaagggcaacgttattgtaccagtgcaggtaatgtagtg
gctacagaaaaaccaagtgtttgggatgcactttcgctgaaaaaagaaaatatcgaggct
aaagcagaagaagctgaagggaagcaaccaatccctactgaagaagttgcaccaattgaa
taa

DBGET integrated database retrieval system