KEGG   Mannheimia haemolytica USMARC_2286: N220_13675Help
Entry
N220_13675        CDS       T02758                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
mhal  Mannheimia haemolytica USMARC_2286
Pathway
mhal00550  Peptidoglycan biosynthesis
mhal01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mhal00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N220_13675
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    N220_13675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mhal01011]
    N220_13675
Enzymes [BR:mhal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     N220_13675
Peptidoglycan biosynthesis and degradation proteins [BR:mhal01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   N220_13675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer SURF1 Sec15
Motif
Other DBs
NCBI-ProteinID: AGR76284
LinkDB All DBs
Position
complement(2594303..2596252)
Genome map
AA seq 649 aa AA seqDB search
MFGKLAKFTASNQREKVRDGQAESNLYARRALVAFLGVLALSGVLLTNLYHLQVVNYEDY
QTRSNGNRIKLLPVPPARGLIYDRNGKVLAENLTYFGLFIVPEKTENIEQTLTELKDIVG
LTDEDIENYHKEKKRSSRYTPIMLKGNLNEAQMARFAVNQYRFPSLDVQAYYKRNYPYGE
LLTHIIGYVAKINENDKKKLQEAGKFGNYAGSHDMGKLGIEKFYEDQLHGVTGFEEVEIN
NRGKVIRKLRDQAGVAGSSIRLSIDVELQQYVMSLIAKHKGAVVVLDPRDSSILAMVSNP
SYDNNLFVGGISGQDYKALLDDPTRPLYSRTTQGTYPPASTIKPFMAVAGLEEGMITPST
TISDPGYWILPGTTQRYRDWKRSGHGATNVNKAITESSDTFFYQLAYKMGIDKMSDWMKK
FGFGVKTGIDIFEESAGVMPTREWKQKRYKKPWVQGDTIPVGIGQGYWISTPLQLAKATA
VLINNGRVNTPHLMLEVQSSNSVTPYQDPLLYEDIKGVPDVYWNLAKQGMYNVNHAANGT
ARKVFAGAFYHSAGKTGTAQVFNLNGKNYDKNAIKKELHDHAWFIGYAPYEQPKIVVALI
LENAGGGGSAAAPVARQIMDYALRKGIGEQPDSQNSEQNKPLVTEEHHE
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtaaattagcaaaattcacagcttcaaaccagcgagaaaaggtgcgagacggg
caggcagaaagcaatctgtatgcccgccgtgccttagttgcgtttctgggggtgttggcg
ttaagtggtgttttattaaccaacttgtatcacttgcaagtggtgaattatgaggactac
caaacccgttcaaacggtaaccgcattaaattgttgcctgtgccaccggctcgaggctta
atttatgaccgtaacggtaaagtattggcggaaaatttaacctatttcgggctgtttatt
gtgcctgaaaagacggaaaacattgagcagactttaaccgagttgaaggatattgttggg
ctgacggacgaagatatcgagaattatcataaagagaaaaaacgcagttctcgctatacc
ccaattatgctcaaaggcaatttgaatgaggctcagatggctcgttttgcggtgaaccaa
taccgttttccaagtttagatgtgcaggcgtattataagcggaattatccttacggcgag
cttttaacccatattatcggttatgtggcgaaaattaacgaaaacgataagaaaaagctg
caagaagccgggaaattcggcaattatgccggttcgcacgatatggggaaattggggatt
gaaaaattctatgaagatcagctccacggtgtcaccggttttgaagaggtagaaattaat
aaccgagggaaagtaatccgtaaattgcgtgaccaagcaggggttgccggtagcagtatt
cgcttgagtattgatgtggaattacagcaatatgtgatgtcgttaattgctaagcataaa
ggggcggtggtggtgcttgaccctcgtgatagcagtattttagcgatggtctcaaaccca
agttatgacaataatttatttgtgggcggtatttcagggcaggattataaagcattattg
gacgatccaacccgaccactttatagccgtactacacaaggcacttatccaccggcttca
actattaagccatttatggcggtggcaggtttggaagagggaatgattaccccttctacc
accatttcagaccccggctattggattttgcccggcactacacaacgttatcgagattgg
aaacgtagcggacacggtgcaactaatgtgaataaagcaattaccgaatcgtctgatacc
tttttctatcaattagcctataaaatggggattgataaaatgtcggattggatgaaaaaa
ttcggtttcggagtgaaaaccggtatcgatatttttgaggaatccgcaggggtaatgcca
acccgtgaatggaaacaaaaacgctataaaaaaccttgggtgcagggcgatactattccg
gttgggattgggcagggctactggatttcgaccccgttacagttggcgaaagccacggcg
gtgttaatcaacaacgggcgggtgaatacaccgcatttaatgcttgaagtgcaaagcagt
aattcggttacgccgtatcaagacccattgttgtatgaagatattaaaggcgtgccggat
gtctattggaatttagcaaaacagggaatgtataacgtaaaccacgccgcaaacggtacg
gcacgaaaagtgtttgccggtgcattttatcattcagcagggaaaaccggtacggctcag
gtgtttaacttaaacggtaaaaattacgataaaaatgcgattaaaaaagagttgcacgac
cacgcttggtttatcggctatgctccttatgaacaacctaaaatagtggtggcattaatt
ttagaaaatgcaggcggtggtggtagtgccgcggctcctgttgctcgtcagattatggat
tatgctttgagaaaaggcattggtgaacagccggattcgcaaaattctgagcaaaataaa
ccgcttgtcacagaggaacatcatgaatag

DBGET integrated database retrieval system