KEGG   Mannheimia haemolytica D171: J450_07075Help
Entry
J450_07075        CDS       T02747                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mham  Mannheimia haemolytica D171
Pathway
mham00564  Glycerophospholipid metabolism
mham01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mham00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    J450_07075
Enzymes [BR:mham01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     J450_07075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 NAD_binding_8 HI0933_like GIDA Pyr_redox_3 Pyr_redox_2 YbjQ_1 Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGQ38875
LinkDB All DBs
Position
1482607..1484202
Genome map
AA seq 531 aa AA seqDB search
MQRHEQLAQVQQTQKWDFIIIGGGASGLGIAVDAASRGYKTLLLESHDFAKGTSSRSTKL
VHGGVRYLANGDVALVREALRERGRLAKNAAHLFKNQSFIIPNYKFKDCVMYRVGLGLYD
MLSGNLSLGKTENISKTEAKRRLPTLNDTGLRTGTVYQDGQFDDSRLAVNMAQTVVEHGG
TVLNHAKVTSLHKTPQGKIDGVTFYDELNQQEHTVFGTAVINATGVFMNDILSMDHGSTK
KFVVPSQGIHLVLDKSFLPSNDALMIPKTSDGRVLFAVPWHEVLVVGTTDTLIENPSYEP
IPLEQEVNFILETAAQYLTKKPTRDDVKAVFAGQRPLAAPEKEGQSTKEVSRSHKVLTDA
TSGLITITGGKWTTYRQMAEDTVEEALKVHSELGNKPCVTVNLPIHGNIPAAQVNLQDHL
YVYGSDIPQLRALMTETPEYAQKIHPRLDYTVAEVIWAVRHEMAQTVEDVLARRVRLLFT
DARAAIDSAAKVAAIMAKELGKDEMWQQQQVIQFLDVAKHYLLVDYQPQPI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagacatgaacagctagctcaagtacaacaaacgcaaaaatgggattttattatt
atcggtggtggcgcaagtggtttggggattgcggtagatgcagcttcccgtggctataaa
accttattattagaaagccatgactttgcgaaaggtacatcgagccgaagcacaaaatta
gtccacggtggcgttcgctatcttgcaaatggcgatgttgcactcgtgagagaagcattg
cgtgaacgaggtcgcttagctaaaaatgcagctcatttatttaaaaaccaaagctttatt
attccaaactacaaattcaaagactgtgtaatgtatcgtgttggtttaggcttatacgat
atgctttcaggcaacctgagtttaggaaagactgaaaacatcagtaaaactgaagcgaaa
agacgtttaccaaccttaaatgatactggtttacgtacaggcactgtttatcaagatggg
caatttgatgactcacgtcttgcagtgaatatggcacaaacggtagtagagcacggcggt
acagtactaaatcacgccaaagtgacttcactgcacaaaacgccacaaggcaaaattgat
ggggtgactttctacgatgaactcaatcaacaagaacatactgttttcggcactgcggtg
attaacgcaaccggcgtatttatgaatgatattttaagtatggatcacggtagcacgaaa
aaatttgtcgtaccaagccaagggattcacttagtattagataaatcattcttaccaagt
aatgatgcgttaatgattccaaaaacctctgacggacgagtgttatttgctgtaccttgg
cacgaagtgttagtcgtagggacaacagatactctgattgaaaatccttcttatgagcca
attccattggaacaagaggtgaactttattttagagacagccgcacaatatctgacaaaa
aaaccaactcgtgatgatgtaaaagcagtctttgccggtcaacgtccgcttgcggcaccg
gaaaaagaaggtcaaagcactaaagaagtatctcgtagtcacaaagttctcactgatgca
accagcggtttgattacgattacaggtggtaaatggacaacttatcgtcaaatggcagaa
gataccgtagaagaagcgttaaaagtccactctgaactaggcaataaaccttgtgtgacc
gtcaacttaccgattcacggtaatattccggcagcacaagtgaatctacaagatcatcta
tatgtatatggctcagatattccacagttacgcgccttaatgactgagaccccggaatat
gcacaaaaaatccatccgagactagattataccgttgcagaagtgatctgggcagttcgc
cacgaaatggcacaaacggttgaggatgtattagctcgccgtgttcgtttgctcttcact
gatgcgagagcggcgattgatagtgcagcaaaagtggctgctattatggcgaaagaatta
ggtaaagatgaaatgtggcaacaacagcaagttatccagttccttgatgttgcgaagcac
tatttattggtagattatcagccacagccaatctaa

DBGET integrated database retrieval system