KEGG   Mannheimia haemolytica D174: J451_07440Help
Entry
J451_07440        CDS       T02748                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mhao  Mannheimia haemolytica D174
Pathway
mhao00480  Glutathione metabolism
mhao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhao00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    J451_07440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mhao02000]
    J451_07440
Enzymes [BR:mhao01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     J451_07440
Transporters [BR:mhao02000]
 Other transporters
  Pores ion channels [TC:1]
   J451_07440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: AGQ41307
LinkDB All DBs
Structure
PDB: 

Position
1445292..1445921
Genome map
AA seq 209 aa AA seqDB search
MKLYGLTGACSFVPHVALEWVKLRANQDYAFQAVSREFIKSAEYLALNPRGNVPLLVDGD
LALTQNQAIVHYLDELYPEAKLFGSKTARDKAKAARWLAFFNSDVHKSFVPLFRLPSYAE
GNETLTKTIRQQSAEQILEQLAFANAHLENHIFFGEEISVADAYLYIMLNWCRLLGLDFS
HLSQLSAFMQRVEADQGVDNVREQEGLKG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatatggattaaccggtgcttgttcatttgtaccacacgttgccctagagtgg
gtgaaattgcgtgccaatcaagattatgcgtttcaagctgttagccgtgaatttattaaa
tcggcggaatatctggctttaaaccctcgtggtaacgtaccattgttggttgatggcgac
ttggccctcacgcaaaaccaagctatcgtccactatttagacgagctttatccggaagct
aaattattcggcagcaaaaccgctcgtgataaagccaaagcggctcgttggttagctttt
ttcaattcagatgtgcataaatcattcgtgccactgttccgcttgccaagttatgcggaa
ggcaatgaaacgctcaccaaaactattcgccaacaatcggctgagcaaattttagaacaa
ctggcttttgcgaatgctcatttagaaaatcatattttctttggcgaagaaatttcggtt
gccgatgcgtatctctacattatgctcaactggtgtcgcctactagggttggatttctct
catctttcccaactttctgcctttatgcaacgagtggaggcagaccaaggcgtagataat
gtgcgtgagcaagaaggcttaaaaggttaa

DBGET integrated database retrieval system