KEGG   Mannheimia haemolytica 89010807N: WC39_00250Help
Entry
WC39_00250        CDS       T03749                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mhaq  Mannheimia haemolytica 89010807N
Pathway
mhaq00564  Glycerophospholipid metabolism
mhaq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mhaq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    WC39_00250
Enzymes [BR:mhaq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     WC39_00250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 NAD_binding_8 HI0933_like GIDA Pyr_redox_3 Pyr_redox_2 YbjQ_1 Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AKA10216
UniProt: A0A248ZW41
LinkDB All DBs
Position
complement(44558..46153)
Genome map
AA seq 531 aa AA seqDB search
MQRHEQLAQVQQTQKWDFIIIGGGASGLGIAVDAASRGYKTLLLESHDFAKGTSSRSTKL
VHGGVRYLANGDVALVREALRERGRLAKNAAHLFKNQSFIIPNYKFKDCVMYRVGLGLYD
MLSGNLSLGKTENISKTEAKRRLPTLNDTGLRTGTVYQDGQFDDSRLAVNMAQTVVEHGG
TVLNHAKVTSLHKTPQGKIDGVTFYDELNQQEHTVFGTAVINATGVFMNDILSMDHGSTK
KFVVPSQGIHLVLDKSFLPSNDALMIPKTSDGRVLFAVPWHEVLVVGTTDTLIENPSYEP
IPLEQEVNFILETAAQYLTKKPTRDDVKAVFAGQRPLAAPEKEGQSTKEVSRSHKVLTDA
TSGLITITGGKWTTYRQMAEDTVEEALKVHSELGNKPCVTVNLPIHGNIPAAQVNLQDHL
YVYGSDIPQLRALMTETPEYAQKIHPRLDYTVAEVIWAVRHEMAQTVEDVLARRVRLLFT
DARAAIDSAAKVAAIMAKELGKDEMWQQQQVIQFLDVAKHYLLVDYQPQPI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagacatgaacagctagctcaagtacaacaaacgcaaaaatgggattttattatt
atcggtggtggcgcaagtggtttggggattgcggtagatgcagcttcccgtggctataaa
accttattattagaaagccatgactttgcgaaaggtacatcgagccgaagcacaaaatta
gtccacggtggcgttcgctatcttgcaaatggcgatgttgcactcgtgagagaagcattg
cgtgaacgaggtcgtttagctaaaaatgcagctcatttatttaaaaaccaaagctttatt
attccaaactacaaattcaaagactgtgtaatgtatcgtgttggtttaggcttatacgat
atgctttcaggcaacctgagtttaggaaagactgaaaacatcagtaaaactgaagcgaaa
agacgtttaccaaccttaaatgatactggtttacgtacaggcactgtttatcaagatggg
caatttgatgactcacgtcttgcagtgaatatggcacaaacggtagtagagcacggcggt
acagtactaaatcacgccaaagtgacttcactgcacaaaacgccacaaggcaaaattgat
ggggtgactttctacgatgaactcaatcaacaagaacatactgttttcggcactgcggtg
attaacgcaaccggcgtatttatgaatgatattttaagtatggatcacggtagcacgaaa
aaatttgtcgtaccaagccaagggattcacttagtattagataaatcattcttaccaagt
aatgatgcgttaatgattccaaaaacctctgacggacgagtgttatttgctgtaccttgg
cacgaagtgttagtcgtagggacaacagatactctgattgaaaatccttcttatgagcca
attccattggaacaagaggtgaactttattttagagacagccgcacaatatctgacaaaa
aaaccaactcgtgatgatgtaaaagcagtctttgccggtcaacgtccgcttgcggcaccg
gaaaaagaaggtcaaagcactaaagaagtatctcgtagtcacaaagttctcactgatgca
accagcggtttgattacgattacaggtggtaaatggacaacttatcgtcaaatggcagaa
gataccgtagaagaagcgttaaaagtccactctgaactaggcaataaaccttgtgtgacc
gtcaacttaccgattcacggtaatattccggcagcacaagtgaatctacaagatcatcta
tatgtatatggctcagatattccacagttacgcgccttaatgactgagaccccggaatat
gcacaaaaaatccatccgagactagattataccgttgcagaagtgatctgggcagttcgc
cacgaaatggcacaaacggttgaggatgtattagctcgccgtgttcgtttgctcttcact
gatgcgagagcggcgattgatagtgcagcaaaagtggctgctattatggcgaaagaatta
ggtaaagatgaaatgtggcaacaacagcaagttatccagttccttgatgttgcgaagcac
tatttattggtagattatcagccacagccaatctaa

DBGET integrated database retrieval system