KEGG   Mannheimia haemolytica 89010807N: WC39_02435
Entry
WC39_02435        CDS       T03749                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
mhaq  Mannheimia haemolytica 89010807N
Pathway
mhaq03030  DNA replication
mhaq03430  Mismatch repair
mhaq03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mhaq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    WC39_02435
   03430 Mismatch repair
    WC39_02435
   03440 Homologous recombination
    WC39_02435
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mhaq03032]
    WC39_02435
   03400 DNA repair and recombination proteins [BR:mhaq03400]
    WC39_02435
Enzymes [BR:mhaq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     WC39_02435
DNA replication proteins [BR:mhaq03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     WC39_02435
DNA repair and recombination proteins [BR:mhaq03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     WC39_02435
SSDB
Motif
Pfam: DNA_pol3_chi SBD
Other DBs
NCBI-ProteinID: AKA10596
UniProt: A0A248ZYE5
LinkDB
Position
complement(473179..473616)
AA seq 145 aa
MKQVQFYLLSQADAAELSAAEMQACELAAQAWRLGKRVLIACETEQQALNIDEALWARDP
DSFVPHNLSGEITTYPTPIEISWKGKRNAQRRDLLISLQTQLPEFIGSFTQIIDFVPVEE
TAKAQARDRYKQYRQLGWQLETIQC
NT seq 438 nt   +upstreamnt  +downstreamnt
gtgaaacaagtacaattttatctattaagccaagccgatgcagccgagctttccgctgct
gaaatgcaagcctgcgaacttgcggctcaagcgtggcgattaggtaaacgggtactgatt
gcatgcgaaaccgagcaacaagcgttaaatattgacgaagcactttgggcaagagatccg
gattcgttcgtgccgcacaatttatcgggagaaatcaccacttacccaacgcctatcgaa
atttcgtggaaaggtaaacgcaatgctcaacgtcgggatttgttgatttcactccaaacc
caactccccgaatttatcggcagttttacccagattattgatttcgtgccggtggaagaa
accgccaaagcacaggctcgtgaccgctataaacaataccgccaacttggttggcaactg
gaaacgatacaatgctaa

DBGET integrated database retrieval system