KEGG   Mannheimia haemolytica 89010807N: WC39_05590Help
Entry
WC39_05590        CDS       T03749                                 

Definition
(GenBank) NADH-ubiquinone oxidoreductase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
mhaq  Mannheimia haemolytica 89010807N
Pathway
mhaq00620  Pyruvate metabolism
mhaq01100  Metabolic pathways
mhaq01120  Microbial metabolism in diverse environments
mhaq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mhaq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WC39_05590
Enzymes [BR:mhaq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     WC39_05590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M
Motif
Other DBs
NCBI-ProteinID: AKA11164
UniProt: A0A547E9G1
LinkDB All DBs
Position
complement(1096482..1097750)
Genome map
AA seq 422 aa AA seqDB search
MSDLKQQALDFHEFPIPGKISVTPTKALDTQHDLALAYSPGVAEPCLAIEKDPSASYRYT
ARGNLVAVISNGTAVLGLGNIGALASKPVMEGKGVLFKKFAGIDVFDIEINETDPEKLVE
IIASLEPTFGGINLEDIKAPECFYVEQKLRERMGIPVFHDDQHGTAIITGAAVINGLQVV
GKAISEVRLVVNGAGASAIACTNLLRSLGVKKENITMCDSKGVIFQGRGDKMDETKQFYA
IEDNGWRTLADAVANADVFLGCSKGGALTQEMVKTMAKDLLILALANPVPEITPAEAKAV
RPDAIVCTGRSDFKNQVNNVLCFPFLFRGALDVGAKTINEEMKMAAAHAIAELAKEPVPF
EVISTYGELSFGPEYIIPTPFDPRLIVNVSIGVAKAAIQSGVATRPITDWEAYAEQLKKL
VA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatttaaaacaacaggcgcttgattttcacgagttcccaatccccggaaaaatt
tccgttactcctactaaagcattagatactcagcacgatttagctttagcgtactctcct
ggggttgctgagccttgcttagcgattgaaaaagatccttcagcttcttatcgttatacg
gcacgaggtaacttagttgcagtaatttctaatggtacagcagtgttaggcttaggcaat
attggtgctttagcaagtaagcctgtgatggaaggcaaaggtgttctatttaagaaattt
gccggaattgatgtgtttgatattgaaattaatgaaactgatccggagaaattagtggag
attattgcatcgttagaaccgacttttggtggtattaatctggaagatattaaagcacct
gaatgtttttatgtagagcaaaaattacgtgaacgtatgggaatccctgtgttccacgat
gatcaacacggtacggcaattattaccggtgcggcggtgattaacggattacaagtggta
ggtaaagcaatttcagaagtacgtttagtggtaaacggtgctggagcatcagcgattgcg
tgtactaacttactccgttcattaggtgtgaaaaaagaaaatatcacaatgtgcgattct
aagggcgttattttccaaggtcgtggtgataagatggatgaaaccaaacaattctatgca
atagaagataatggttggagaacattggcagatgccgttgcgaatgcagatgttttctta
ggttgttcaaaaggcggagctttaacgcaagaaatggttaaaacaatggcaaaagatcta
ttaattcttgctttagcgaaccctgtgccggaaattacacctgctgaagcgaaggctgtc
cgtccagatgcgattgtatgtaccggtcgttcagactttaaaaaccaagtgaataatgtg
ctttgtttcccgttcttattccgtggagcattagatgttggggcaaaaaccattaatgaa
gaaatgaaaatggcagcagcccatgcgattgcagagttggctaaagaacctgtgccgttt
gaagttatttcaacttatggcgaattatcgtttggcccggaatatattattccaacgcca
tttgatccacgtttgatcgtgaatgtctcgattggtgtagcaaaagcagcaattcaatca
ggtgtagcaactcgaccaattacagattgggaagcttatgcagagcagttgaaaaaactg
gttgcttaa

DBGET integrated database retrieval system