KEGG   Mannheimia haemolytica 89010807N: WC39_07195Help
Entry
WC39_07195        CDS       T03749                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mhaq  Mannheimia haemolytica 89010807N
Pathway
mhaq00240  Pyrimidine metabolism
mhaq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhaq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    WC39_07195
Enzymes [BR:mhaq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     WC39_07195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14
Motif
Other DBs
NCBI-ProteinID: AKA11469
UniProt: A0A249A046
LinkDB All DBs
Position
1415579..1416160
Genome map
AA seq 193 aa AA seqDB search
MAKLYFYYSSMNAGKSTTLLQSSYNYQERGMNTLVYTAAIDDRFGVGKVNSRIGISQEAN
LFTADTNLFAEIKALHSNKALHCILIDEAQFLTKTQVYQLSDVVDKLKIPVLCYGLRTDF
QAELFEGSKYLLAWADELEELKTICDCGKKAHFVVRLNEKGEAIKDGEQIQIGGNDRYLS
VCRYHYKQKLGKL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttttactactcctcaatgaatgcaggcaaatctactactctgctt
caatcttcttataattaccaagaacgtggaatgaacactttagtttataccgccgctatt
gatgaccgtttcggtgtggggaaagtcaactctcgtatcggtatttcacaagaagccaat
ttatttaccgctgataccaatctatttgcggaaattaaggcattacactcaaacaaagcg
ttacactgtatcttgattgatgaggctcagtttttaactaaaacacaggtttatcaatta
agtgatgtggtcgataaactcaaaattccggtgctttgctacgggctacgcaccgatttc
caagctgaattatttgaaggtagcaaatatttgttggcttgggcagatgagctggaagaa
ctcaaaaccatctgtgattgtggcaaaaaagcccattttgtcgttcgattaaatgaaaaa
ggcgaagccattaaagacggtgaacaaatacaaatcggcggcaatgatagatatctctct
gtttgccgttatcattacaaacaaaagttaggtaagctataa

DBGET integrated database retrieval system