KEGG   Mannheimia haemolytica 89010807N: WC39_08000
Entry
WC39_08000        CDS       T03749                                 

Definition
(GenBank) conjugal transfer protein
Organism
mhaq  Mannheimia haemolytica 89010807N
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: AKA11615
UniProt: A0A547E984
LinkDB
Position
1580497..1581438
AA seq 313 aa
MKRAFFSVLLSVSLAVPTTLYPQQVKASLNTASIAASSASTSCLDYKVVGTCFWLFCTYF
GCKVRTSTKIKHYLPEMVVSSYNQDGQTPWTELQSLNPGVKGGEYRSPQRQYSQLTFKNA
DAFGHPQGAIGQLLGSTGYYCKSQTTPFIPYFLSGLDFFAWRENMPEMFYPEALIPGMRE
VGRVGDSWGNIYPRSGWVTQAHDYKASATIVQRVADIVTRTAQPHIYFPAAKKGGVGEWP
PGPVEEGQARTHKWQMLYPQMSNTCSVFPNGGQTDTYSSQISNQGDYAWALWRPYSCCKR
RGQTFLYSIDWSH
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaaaagagcgtttttttcggtacttctctctgtaagtttagcagtaccaacaacctta
tatcctcaacaggtaaaagcatcattgaatacggcgtcgattgctgcatcaagtgcctca
acaagctgtttagactataaagtcgtcggaacgtgcttctggttattttgcacctacttt
ggatgcaaggttcgtacatcaaccaaaattaagcattatttaccggaaatggtcgtttca
tcttataaccaggatgggcaaactccgtggacagaattacaatctctcaatcctggcgta
aaaggcggagaatatcgttctccgcaacgtcaatactctcaactaaccttcaaaaatgca
gatgctttcgggcatccccaaggagcaattggtcagttattaggaagtacaggctactat
tgtaaaagtcaaaccacaccatttataccctattttctaagtggattagatttctttgct
tggcgtgaaaatatgccggaaatgttttatccggaagctctgattccgggaatgcgggaa
gttggccgtgtaggcgatagctggggaaatatttacccacgttccggttgggtaacacaa
gctcacgattataaagcctctgcaaccattgtgcagagagttgcagacatcgtgacccga
actgctcaaccacatatttatttcccggcagcgaaaaaaggtggtgttggagaatggcca
ccaggacctgtcgaagaaggacaagccagaacacataaatggcaaatgctttatcctcaa
atgtcaaatacctgctctgtttttccaaatggggggcaaacagacacctattcctctcag
atttcaaatcaaggtgattatgcttgggcactatggcgaccttatagttgttgtaaacgc
cgagggcaaacattcctttacagtattgattggtcacactaa

DBGET integrated database retrieval system