KEGG   Mycolicibacterium hassiacum: MHAS_00197Help
Entry
MHAS_00197        CDS       T05715                                 

Definition
(GenBank) Putative enoyl-CoA hydratase EchA13
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mhas  Mycolicibacterium hassiacum
Pathway
mhas00071  Fatty acid degradation
mhas00280  Valine, leucine and isoleucine degradation
mhas00281  Geraniol degradation
mhas00310  Lysine degradation
mhas00360  Phenylalanine metabolism
mhas00362  Benzoate degradation
mhas00380  Tryptophan metabolism
mhas00410  beta-Alanine metabolism
mhas00627  Aminobenzoate degradation
mhas00640  Propanoate metabolism
mhas00650  Butanoate metabolism
mhas00903  Limonene and pinene degradation
mhas00930  Caprolactam degradation
mhas01100  Metabolic pathways
mhas01110  Biosynthesis of secondary metabolites
mhas01120  Microbial metabolism in diverse environments
mhas01130  Biosynthesis of antibiotics
mhas01212  Fatty acid metabolism
Module
mhas_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mhas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MHAS_00197
   00650 Butanoate metabolism
    MHAS_00197
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MHAS_00197
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MHAS_00197
   00310 Lysine degradation
    MHAS_00197
   00360 Phenylalanine metabolism
    MHAS_00197
   00380 Tryptophan metabolism
    MHAS_00197
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MHAS_00197
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MHAS_00197
   00281 Geraniol degradation
    MHAS_00197
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MHAS_00197
   00627 Aminobenzoate degradation
    MHAS_00197
   00930 Caprolactam degradation
    MHAS_00197
Enzymes [BR:mhas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MHAS_00197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 ACP_syn_III_C DUF3756 SDH_sah DUF5320
Motif
Other DBs
NCBI-ProteinID: VCT88513
UniProt: K5B956
LinkDB All DBs
Position
1:230806..231744
Genome map
AA seq 312 aa AA seqDB search
MTHAIRPVDFDNLKTMTYEVTGRVARITFNRPEHGNAIVADTPLELSACVERADLDPDVH
VILVSGRGSGFCAGFDLSAYAEGSSSAGGGEAYRGTVLSGRTQALNHRPDQPWDPMIDYQ
MMSRFVRGFASLMHADKPTVVKIHGYCVAGGTDIALHADLIVAAADAKIGYPPTRVWGVP
AAGMWAHRLGDQRAKRLLFTGDCITGAQAAEWGLAVEAPPPEELDERTERLVERIAALPV
NQLIMVKLAMNSALYNQGVANSAMISTVFDGIARHTPEGHEFVAQARELGFREAVRRRDE
PFGDYGRRASGV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgcgatcaggccggtcgacttcgacaacctcaagaccatgacctacgaggtg
accggccgggtggcccgcatcaccttcaaccggcccgaacacggcaacgcgatcgtcgcc
gacaccccgctggagttgtcggcgtgcgtcgagcgtgccgacctcgaccccgatgtgcac
gtgatcctggtgtccggccgcgggtcggggttctgcgccgggttcgacctgtccgcctac
gccgagggctcgtcgtcggccggcggcggcgaggcctaccgtggcaccgtgctgtccggg
cggacccaggcgctcaaccaccggcccgaccagccctgggacccgatgatcgactaccag
atgatgagccggttcgtgcggggcttcgccagcctgatgcacgccgacaagccgaccgtc
gtcaagatccacgggtactgcgtggccggcggcaccgacatcgcgctgcacgccgacctc
atcgtcgcggcggccgacgccaagatcggctacccaccgacgcgggtgtggggtgtgccg
gccgccgggatgtgggcgcaccggctcggcgaccagcgcgccaaacgcctgctgttcacc
ggcgactgcatcaccggcgcccaagccgccgagtggggcctggccgtcgaggcgccgccg
ccggaggaactcgacgagcgcaccgagcggctggtcgagcgcatcgcggcgttgccggtc
aaccagctgatcatggtcaagctcgcgatgaactcggcgctgtacaaccagggcgtggcc
aacagcgcgatgatctccaccgtgttcgacgggatcgcccggcacacccccgaaggccac
gaattcgtcgcccaggcacgcgaactcgggttccgcgaagcggttcgccgacgcgacgag
ccgttcggcgactacggccgccgcgcctcaggggtgtga

DBGET integrated database retrieval system