KEGG   Mycolicibacterium hassiacum: MHAS_00958Help
Entry
MHAS_00958        CDS       T05715                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mhas  Mycolicibacterium hassiacum
Pathway
mhas00473  D-Alanine metabolism
mhas00550  Peptidoglycan biosynthesis
mhas01100  Metabolic pathways
mhas01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mhas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MHAS_00958 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MHAS_00958 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MHAS_00958 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mhas01011]
    MHAS_00958 (ddl)
Enzymes [BR:mhas01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MHAS_00958 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:mhas01011]
 Precursor biosynthesis
  Amino acid ligase
   MHAS_00958 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 RimK CPSase_L_D2 ATPgrasp_ST ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: VCT89268
UniProt: A0A3P3ZVA8
LinkDB All DBs
Position
1:1008461..1009549
Genome map
AA seq 362 aa AA seqDB search
MRVAVVYGGRSSEHAISCVSASSILRNLDPERFEVITVGITPDGTWVLTQADPDALAITD
GRLPEVTRSAGTELALVADPARRGQLVSLANPTELLGTVDVVFPVLHGPYGEDGTIQGLL
ELAGVPYVGAGVLASAAGMDKEFTKKLLLAAGLPVGDHIVLRPPQDRLTVDEQERLGLPV
FVKPARGGSSIGVSRVTAWDQLPVAVEFARRHDPKVIVEAAIVGREIECGVLEFPDGRVE
ASTVGEIRVAGVRGREDGFYDFETKYLADSAELDVPAKVADDVADELRDLAIRAFRAIDC
QGLARVDFFLTDGGPLINEINTMPGFTTISMYPRMWAASGVDYPTLLATMVETALARGTG
LR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtcgccgtggtgtacggcgggcgcagctccgagcatgcgatctcgtgcgtctcc
gccagcagcatcctgcgcaacctcgaccccgagcgtttcgaggtcatcacggtcggcatc
acgcccgacggcacctgggtgctgacccaggccgatccggatgcgctggccatcaccgac
ggccggttgcccgaggtgacccggtccgcgggcaccgagctggcgctggtggccgatccg
gcacggcgcggccagctggtgtcgttggcgaatccgaccgagctgctcggcacggtggac
gtggtgttcccggtgctgcacgggccgtacggcgaggacggcaccatccaggggctgctg
gagctggccggcgtgccctatgtcggcgccggcgtgttggccagcgcggcggggatggac
aaggagttcaccaagaagctgttgctcgccgcggggctgccggtcggcgaccacatcgtg
ctgcggccgccgcaggaccggttgaccgtcgacgagcaggaacggctcgggctgccggtg
ttcgtcaaaccggcgcggggcgggtcgtcgatcggggtcagccgggtgaccgcctgggac
cagttgcccgtcgccgtcgagttcgcgcgtcgccacgacccgaaggtgatcgtcgaggcg
gctatcgtcggccgggagatcgagtgtggcgtgttggagtttcccgacggccgggtcgag
gccagcaccgtcggcgagatccgggtggccggcgtgcgtggccgcgaggatggtttctac
gatttcgagaccaagtatctggccgactccgccgagctcgacgttcccgcgaaggtggcc
gacgacgtcgcggatgagttgcgggacttggcgattcgcgccttccgtgcgatcgactgc
cagggtctggcccgggtcgacttcttcctcaccgacggcgggccgctgatcaacgagatc
aacaccatgcccggattcaccacgatctcgatgtatccgcggatgtgggccgccagcggg
gtcgattatccgaccctgctcgccaccatggtggagaccgcgctggcgcgcggcacgggt
ctgcgctga

DBGET integrated database retrieval system