KEGG   Mycolicibacterium hassiacum: MHAS_01427Help
Entry
MHAS_01427        CDS       T05715                                 

Gene name
gsiA_2
Definition
(GenBank) Glutathione import ATP-binding protein GsiA
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
mhas  Mycolicibacterium hassiacum
Pathway
mhas02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mhas00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MHAS_01427 (gsiA_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mhas02000]
    MHAS_01427 (gsiA_2)
Transporters [BR:mhas02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    MHAS_01427 (gsiA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N oligo_HPY AAA_21 AAA_29 AAA_22 AAA_16 SbcCD_C IstB_IS21 RsgA_GTPase AAA_24 Mg_chelatase MMR_HSR1 APS_kinase AAA_25 PRK AAA_30
Motif
Other DBs
NCBI-ProteinID: VCT89729
UniProt: K5B883
LinkDB All DBs
Position
1:complement(1530572..1532197)
Genome map
AA seq 541 aa AA seqDB search
MSAPTLAVRGLRVRIGAREIVHGVSFEVHREQTLGIVGESGSGKSLTVLAATGLLDAPGA
VVTGTSTLTGSPGTVELVGAGARTLRTVHGGRIGFVFQDPGTSLNPLLTVGRQITESLET
HRNMTRRQAQGRALELLAAVGLPDPQARLHSYPHQLSGGQRQRVMIAIAMACDPELLVAD
EPTTALDVTTQAQIIELVRDLQRDTGTAVVWISHDLGVIGQVADDVTVLRDGAAVEQASV
LRVFDHPQHPYTAELLEARPVIGSSAPPVGDTDAEPLLVVDGLDVRFDVHTPVGRTRVHA
VRDLSFSVRRGRTLGLVGESGSGKSTVAAALTGLVRPDAGTATLDGADLIGARGAAARAL
RRRVALVFQDPFASLNPRMRVGDSIAEPLRVHRLARGRTARRRRIAELLELVGLPAVFAD
RYPHELSGGERQRVSLARALAGEPELLILDEATASLDVSVQARMLGLLSRLQSELGLTYL
FIAHDLAVVQRMSHEVLVLRDGAAVEYRPAAELFAAPEHEYTRALLAAVPPQRPRVRADR
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgccgacgctcgcggtgcgcgggttacgggtgcgcatcggcgcccgcgagatc
gtgcacggggtctccttcgaggtgcaccgcgaacagacgctgggcatcgtcggcgaatcc
ggctcgggcaagtcgctgaccgtgctggccgcgaccggtctgctcgacgcacccggtgcc
gtcgtcaccggcaccagcaccctcaccggttcgccgggcaccgtcgaactcgtcggtgcc
ggtgcgcgcaccctgcgcaccgtccacggcggacggatcgggttcgtgttccaggatccc
ggcacgtccctgaacccgctgttgaccgtcggccgccagatcaccgaatcacttgagacg
caccgcaatatgacgcggcgacaggcccagggccgggcgctggagctgctcgcggcggtg
gggctgcccgatccgcaggcgcggttgcactcctatccgcatcagctctcgggtgggcag
cgccagcgggtgatgatcgcgatcgcgatggcctgcgacccggaactgctggtcgccgac
gagccgaccaccgcactcgatgtgaccacccaggcgcagatcatcgagctggtgcgcgac
ctgcagcgggataccggtaccgcggtggtgtggatcagccacgacctcggggtcatcggc
caggtcgccgacgatgtcaccgtgctgcgcgacggggcggcggtggagcaggcgagcgtg
ctgcgggtcttcgatcacccgcagcacccctatacggccgagctgctcgaagcccggccg
gtgatcggatcctccgcacctcccgtcggtgacaccgacgccgaaccgctgctggtggtg
gacggcctggatgtgcgtttcgatgtacacacgccggtcggccgcacgcgggtgcacgcg
gtgcgtgatctgtcgttctccgtgcgccgcggccggaccctgggcctggtcggcgaatcc
gggtcgggtaagtccacggtggcggcggcgctgaccgggctggtgcgtccggacgccggc
accgccacgctcgacggtgccgacctgatcggggcgcgcggcgccgccgccagagcgctg
cgccggcgggtggcgctggtgtttcaggacccgttcgcctcgctcaacccgcggatgcgc
gtaggggactcgattgccgaaccgttgcgggtgcaccggctggcccggggtcggaccgca
cgccgccgccggatcgcggaactgctcgaactggtcggcctgccggctgttttcgccgac
cgctacccgcatgaactgtccggcggggaacgccagcgggtcagcctagcccgcgcgctg
gccggcgagcccgagttgttgatcctcgacgaggccaccgcctcgctggacgtctcggtg
caggcgcggatgctggggttgttgtcgcggctgcagtccgagctcgggctgacgtacctg
ttcatcgcccacgacctggccgtggtgcagcggatgagccacgaggtgctggtgctgcgc
gacggcgctgcggtcgaatatcggcccgccgctgagcttttcgccgctccggagcacgag
tacacccgcgcgctgctggctgcggtgccgccgcagcgtccacgggtgcgcgccgaccgg
cggtga

DBGET integrated database retrieval system