KEGG   Mycolicibacterium hassiacum: MHAS_02581Help
Entry
MHAS_02581        CDS       T05715                                 

Gene name
geoB_2
Definition
(GenBank) Geranial dehydrogenase
Organism
mhas  Mycolicibacterium hassiacum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF742 LuxC
Motif
Other DBs
NCBI-ProteinID: VCT90872
UniProt: K5BHD0
LinkDB All DBs
Position
1:2745192..2746634
Genome map
AA seq 480 aa AA seqDB search
MRHHELFIGGTWRRPTGAATIEVVSPHTEEPIAQVAAATPDDVDAAVAAARMAFDEGPWP
RLAPAERVAAIRRLTDRYGERTAEMAEVITAELGAPISFAQRAQVGLPALMMGAFCDLAD
AFPWTELRRGRYGADIRIRREPVGVVAAVVPWNMPQFLIVTKLVPALLAGCTVVVKPAAE
SPLDALLLAEMLGELDLPPGVVSVLPGDGTAGGHLVAHPGIDKVSFTGSTATGKAVAAAC
ATRLCRVSLELGGKSAAIVLDDADPQQVAAAVRSASLSNSGQICNALTRVLVPASRADDF
VDALVTELESIVVGDPTDPATQMGPLVSRRQRQRVLAYIESGLDEGARLATGGVGMPDGL
SRGWYVRPTLFVGDNSMTIAREEIFGPVLTVIPYADEDEALRIANDSDYGLAGSVFTADT
DRGLAVAERIRTGTFGVNQGYTMDPFAPFGGVKASGYGRELGTEGIEGYTETKSIAVAGP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccaccacgagttgttcatcggcggcacctggcggcggcccaccggcgccgccacg
atcgaggtggtcagcccgcataccgaggagccgatcgcgcaggtcgccgcggccaccccg
gatgacgtcgacgccgcggtggcggccgcccggatggccttcgacgagggaccgtggcca
cggctggcgccggccgagcgggtcgcggcgatccgccgactgaccgaccgctacggcgag
cgcaccgccgagatggccgaggtgatcaccgcggaactgggcgcaccgatcagcttcgcg
cagcgcgcgcaggtcgggctgccggcgctgatgatgggcgcgttctgcgacctcgccgac
gccttcccctggaccgagctgcgccggggccgctacggtgccgacatccgaatccgccgc
gaacccgtcggcgtcgtcgccgcggtggtgccgtggaacatgccgcagttcctgatcgtc
accaagctcgtacccgcactgctggccgggtgcacggtggtggtcaaaccggccgccgaa
tccccgctcgacgcactgctgctcgccgagatgctcggcgagctcgacctgccgccgggg
gtggtcagtgtgctgccgggcgacggcaccgccggcgggcacctggtcgcccatccgggg
atcgacaaggtgtcgttcaccgggtccaccgcgacgggcaaggcggtcgccgccgcgtgt
gccacccggctgtgccgggtcagcctggagctgggcggcaagtcggcggcgatcgtgctc
gacgacgccgacccgcagcaggtggccgccgcggtgcgctcggcgagcctgtccaacagc
gggcagatctgcaacgcgctgacccgggtgctggtacccgcttcgcgggcagacgatttc
gtcgacgccctggtcaccgagctggagtcgatcgtggtgggcgaccccaccgacccggcc
acccagatgggcccgctggtctcgcgccggcagcggcaacgggtactcgcctacatcgag
tccggactcgacgagggtgcgcggctggccaccggtggggtggggatgcccgacgggctg
agccgcggatggtatgtgcggccgacgctgttcgtcggcgacaactcgatgaccatcgcc
cgggaggagatcttcggcccggtcctgacggtcattccgtacgccgacgaggacgaggcg
ctgcgcatcgccaacgactcggactacgggctggccggctcggtgttcaccgccgacacc
gaccgtggcctggccgtcgccgagcgcatccgcaccggcacgttcggcgtgaatcagggc
tacaccatggatccgttcgctccgttcggcggagtcaaggccagcggatacggccgcgaa
ctcggcaccgaggggatcgagggctacaccgaaaccaagtcgatcgcggtcgccggcccc
tag

DBGET integrated database retrieval system