KEGG   Mycolicibacterium hassiacum: MHAS_03950Help
Entry
MHAS_03950        CDS       T05715                                 

Gene name
ligC_1
Definition
(GenBank) DNA ligase C1
Organism
mhas  Mycolicibacterium hassiacum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: VCT92223
LinkDB All DBs
Position
1:complement(4209428..4210474)
Genome map
AA seq 348 aa AA seqDB search
MEPVDLPVLPPLEPMLAKAQTAVPTDEDTWSYEPKWDGFRALVFRDRDEVVLVSRNGRDL
GRYFPEVVEAVREELAPRCVLDGEIVVPREIDGRTRLDWESLSQRIHPAASRIKLLADQT
PAHFIGFDALAVGDTALMSEPFTVRRRALVDAVDEKQWCHVTRATTDPVLGAQWLDTFEG
AGLDGVIAKRLDGPYLPGKREMVKVKHVRDADCVAIGYRIHKSGEGVGSILLGLYRGDEL
HMVGGAASFTVKDRKKLLAELEPLRIGDTVLDGEPSRWNSAADKRWIPIRPERVCQVTYD
QMEGNRGAQRFRHAVRFVRWRPDREPSSCTFDQLDVPLHYDLRDVLES
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgtggaccttcccgtgctgccgccgctggagccgatgctggccaaggcgcag
accgccgtcccgaccgacgaggacacctggtcctacgaaccgaaatgggacgggttccgg
gccctggtgttccgcgaccgtgacgaggtggtcctggtgtcccgcaacggccgcgacctg
ggccgctacttccccgaggtcgtcgaggcggtgcgggaggaactggcgccccggtgcgtg
ctcgacggcgagatcgtggtgccccgcgagatcgacggccgcacccggctggactgggag
tcgctgagccagcgcatccacccggccgccagccggatcaaactgctcgccgaccagacg
cccgcgcacttcatcgggttcgacgcgctggccgtcggcgacaccgcgctgatgagcgaa
ccgttcaccgtgcggcgccgagcgctcgtcgacgcggtggacgagaagcagtggtgccac
gtcacccgcgccaccaccgaccccgtgctgggcgcgcagtggctcgacaccttcgaaggc
gccggcctcgacggggtgatcgccaaacggctcgacggcccctatctgcccggcaagcgg
gagatggtgaaggtcaaacacgtgcgcgacgcggactgcgtggcgatcgggtaccgcatc
cacaagagcggcgagggcgtcggctcgatcctgctcggcctctatcgcggcgacgaactg
cacatggtcgggggcgcggcgtcgttcacggtcaaggaccgcaagaaactactggccgag
ctggaaccgctgcgcatcggcgacacggtgctcgacggcgagcccagccggtggaactcc
gcggccgacaagcgctggatcccgatccgtccggagcgggtctgccaggtgacctacgac
cagatggagggcaaccgcggcgcccagcggttccgccacgcggtccggttcgtgcgctgg
cgacccgaccgcgagccgagcagctgcaccttcgaccaactcgacgtcccgctgcactac
gacctgcgcgacgtgctggagtcctga

DBGET integrated database retrieval system