KEGG   Mycolicibacterium hassiacum: MHAS_03954Help
Entry
MHAS_03954        CDS       T05715                                 

Gene name
ligC_2
Definition
(GenBank) DNA ligase C
Organism
mhas  Mycolicibacterium hassiacum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: VCT92227
UniProt: K5BL03
LinkDB All DBs
Position
1:4212185..4213255
Genome map
AA seq 356 aa AA seqDB search
MHLPVMPPVSPMLAKPVGRIPPGACYEPKWDGFRSVVFRDGNEVELGSRNERPLTRYFPE
LVEGARSELPVRCVVDGEIVVAVGGALDFDALQQRIHPAASRVEMLSERTPAAFIAFDLL
ALGDYDLTALPFRRRRALLVDVLAGAGWSFHVTPATTDIDTAQRWFGEFEGAGLDGLIAK
PPNLTYQPDKRVMFKVKHTRTADCVVAGYRPHKSGDDAVGSLLLGLYTDDGALAFIGVIG
AFPMATRRALFSELQPLVTTFDRHPWNWAEPATDRTPRHAAGSRWSAGKDLSFVPLRPER
VVEVRYDHMAGGRFRHTAQFGRWRPDRDPRSCTFGQLETPPAYRLGDIVPGLDYGM
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcatctgcccgtgatgccgccggtgtcaccgatgctcgccaaaccggtgggccggatc
ccgccgggcgcgtgctacgagccgaagtgggacggcttccggtcggtggtgttccgcgac
ggcaacgaggtcgaactgggcagccgtaacgagcggccgctgacccgctacttccccgaa
ctcgtcgagggcgcccgatcggagttgccggtgcgctgcgtggtcgacggcgagatcgtg
gtcgcggtcggcggggcgctcgatttcgacgcgctgcaacagcgcatccaccccgccgcc
agccgggtcgagatgctctccgagcgcaccccggcggcgttcatcgcgttcgatctgctg
gccctcggcgactacgacctcaccgcgttgccgttccggcgccggcgcgccctgctcgtc
gacgtgttggccggggcgggctggtcgttccacgtcacgccggcgaccaccgatatcgac
accgcgcagcggtggttcggcgagttcgagggcgccgggctggacgggctgatcgccaaa
ccgccgaacctgacgtatcagcccgacaagcgggtgatgttcaaggtcaagcacacccgc
accgccgactgtgtggtggccgggtaccggccgcacaaatccggcgacgacgcggtcggc
tccctgttgctcggcctgtacaccgacgacggcgcactggccttcatcggcgtcatcggc
gcgttcccgatggccacccgccgcgcgttgttctccgaattgcagcctctggtcacgact
ttcgaccggcatccgtggaactgggcggaaccggcaaccgaccgcacaccccgccacgcc
gccggctcgcggtggagcgccggcaaggacctgtcgttcgtgccgctgcggcccgagcgg
gtggtcgaggtgcgctacgaccacatggctggcgggcggttccgccacaccgcgcagttc
ggccggtggcgccccgaccgggacccgcgcagctgcaccttcgggcaattggagaccccg
ccggcctaccggctcggcgatatcgttcccggcctcgactacggcatgtga

DBGET integrated database retrieval system