KEGG   Mycolicibacterium hassiacum: MHAS_03970Help
Entry
MHAS_03970        CDS       T05715                                 

Gene name
tcyB
Definition
(GenBank) L-cystine transport system permease protein TcyB
Organism
mhas  Mycolicibacterium hassiacum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 BPD_transp_1 Phosphonate-bd OpuAC Lig_chan-Glu_bd NMT1
Motif
Other DBs
NCBI-ProteinID: VCT92243
UniProt: A0A3P4A3Q8
LinkDB All DBs
Position
1:4225864..4227345
Genome map
AA seq 493 aa AA seqDB search
MQYLPPVHRNRRRVLPALLLFVAVIAGVAGCGSSRDAGTDPIKAAGVLRVGTEGVYPPYS
FHDPAQGGRLAGYDVDVARAVAEKLGVRVEFVETSWDSIFAALEAGRFDVVANEVTITDE
RKAKYDLSEPYSIAEGVIVTRADDDSITSLADLKGRRAAQSPTSNWARVARDAGAEIVSV
DGFAQAISVLNDGRVDAVVNDSLSVLAYQAEHPDAAIKVAATTGERSEQAFAARKNSGLL
PELNRALDELRADGTLTEISRKYLDTDLSRSTPRSTVQLILDNLCPLARAAIEETIPLTV
ISFVIGLVIALVVALARLSSNVLLSGLARMYISLIRGTPLLVQLFLVFYALPQIGVRIDP
FPAAVIAFSLNVGGYAAEIIRSAILSIPKGQWEAAQTIGLNYVDTYRRIILPQATRVAVP
PLSNTLISLVKDTSLASTILVTELFRTAQNVAAPTFEFFALYGTAALYYWVICLVLSFGQ
SRLERRLERYVAR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtaccttccgccggtgcaccgaaaccgccggcgggtgctacccgctcttctgctg
ttcgtggcggtgatcgccggggtggccggttgcggctcctcccgcgacgccggcaccgat
ccgatcaaggccgcgggggtgctccgggtcggcaccgagggcgtctacccgccgtactcc
ttccacgaccccgcgcagggcggccgactggccggctacgacgtcgacgttgcccgcgcc
gtcgccgagaaactcggcgtgcgagtcgagttcgtcgagacgtcatgggattcgatcttc
gccgcactggaggcgggccggttcgacgtcgtcgccaacgaggtgaccatcaccgatgag
cgcaaggcgaaatacgacctctccgagccgtattcgatcgccgaaggggtgatcgtcacc
cgcgccgacgacgactcgatcacctcgctggccgacctgaagggcaggcgcgcagcgcag
agcccgaccagcaactgggcgcgggtggcccgcgacgccggtgcggagatcgtgtcggtg
gacgggttcgcgcaggcgatcagcgtgctcaacgacggacgcgtcgacgccgtggtcaac
gacagcctgtcggtgctggcgtatcaggccgagcacccggacgcggcgatcaaggtggcc
gccaccaccggtgagcgcagcgagcaggcgttcgccgcccgcaagaacagcgggctgctg
cccgaactgaaccgggcgctcgacgagctgcgcgccgacggcaccctgaccgagatctcg
cgcaagtacctcgacaccgacctgtcgcggtccacgccgcgcagcaccgtgcagctgatc
ctcgacaatctgtgtccgctggcgcgcgcggcgatcgaggagacgatcccgctgaccgtg
atcagcttcgtcatcggcctggtgatcgcgctggtggtggcgctggcgcggctgtcgtcg
aacgtgctgctgtccgggctggcccggatgtacatctcgctgatccgcggcaccccgctg
ctggtgcagctgttcctggtgttctacgcgctgccgcagatcggggtgcgcatcgacccg
ttccccgccgcggtcatcgcgttcagcctcaacgtcggcggctacgcggccgagatcatc
cggtcggcgatcctgtccatcccgaagggccagtgggaggccgcccagacgatcgggctg
aactacgtcgacacctaccggcggatcatcctgccgcaggccacccgggtggcggtgccg
ccgctgtcgaacacgttgatctcgctggtgaaggacacctcgctggcgtcgacgatcctg
gtgaccgaactgttccgcaccgcgcagaacgtcgccgcgccgacgttcgagttcttcgcg
ctctacggtactgcggccctgtactactgggtcatctgcctggtgctgtcgttcggccag
agtcggctcgagcgtcgactggaaaggtatgtggcccgatga

DBGET integrated database retrieval system