KEGG   Mycolicibacterium hassiacum: MHAS_03998Help
Entry
MHAS_03998        CDS       T05715                                 

Gene name
mmgC_10
Definition
(GenBank) Acyl-CoA dehydrogenase
Organism
mhas  Mycolicibacterium hassiacum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: VCT92271
UniProt: K5BHI5
LinkDB All DBs
Position
1:4253038..4254213
Genome map
AA seq 391 aa AA seqDB search
MSALSITPNLPDEEQLLVQTVRDFINREVRPAVRELEHANTYPEAWIEQMKQIGIYGLAI
PEEYGGNPVSMPCYVEVTQELSRGWMSLAGAMGGHTVVAKILTLFGTEEQKQRYLPKMAT
GEIRATMALTEPGGGSDLQNMKTTALPSEGGGLAVNGSKIWISNARRSGLIALLCKTDPN
AQPRHKGISVVLVEQGTTGMSVSRDLPKLGYKGVESCEVVFEDCRVPASAILGGVPGKGF
AQMMKGLETGRIQVAARALGVATAALEDALRYAQDRESFGQPIWKHQSIGNYLADMATKL
TAARQLTRYAAERYDSGERCDMEAGMAKLFASEVAMEIALNAVRIHGGYGYSTEFDVERY
FRDAPLMIVGEGTNEIQRNVIVNQLIARGGI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccttatccatcaccccgaacctccccgacgaggaacagctgctggtgcagacc
gttcgcgacttcatcaaccgcgaggtcagaccggcggtccgcgaactcgaacacgccaac
acctatcccgaggcgtggatcgagcagatgaagcagatcggcatctacggcctggccatc
cccgaggagtacggcggcaacccggtctcgatgccgtgctacgtcgaggtcacccaggaa
ctgtcccgcggctggatgagcctggccggcgcgatgggcggccacaccgtggtggccaag
atcctcaccctgttcggcaccgaggagcagaagcagaggtatctgcccaagatggccacc
ggcgagatccgcgccaccatggcgctgaccgaaccgggcggcgggtcggacctgcagaac
atgaagaccaccgcgctgccgtccgagggcggcgggctggccgtcaacggctcgaagatc
tggatctccaacgcccgccggtccggcctgatcgcgctgctgtgcaagaccgacccgaac
gcccagccgcggcacaagggcatctcggtggtgttggtggagcagggcaccacgggcatg
tcggtgtcacgggacctgcccaaactcggctacaagggcgtggagtcctgcgaggtggtc
ttcgaggactgccgggtgccggcgtcggcgatcctcggcggggtgcccggcaagggcttc
gcgcagatgatgaaaggccttgagacgggccggatccaggtggccgcccgggcactcggc
gtggcgaccgccgcgctggaggacgcgctgcgctacgcccaggaccgggagagcttcggc
cagccgatctggaaacaccagtccatcggcaactacctggccgacatggccaccaaactg
accgccgcgcgccagctcacccgctacgccgccgagcgctacgacagcggcgagcgctgc
gacatggaggccggcatggccaagctgttcgcctccgaggtggcgatggagatcgcgctc
aacgcggtgcgcatccacggcggctacggctactccaccgaattcgatgtcgagcggtac
ttccgcgacgccccgctgatgatcgtcggcgagggcaccaacgagatccagcgcaacgtg
atcgtcaaccaactgatcgcccgcggcggaatctag

DBGET integrated database retrieval system