KEGG   Mycolicibacterium hassiacum: MHAS_04798Help
Entry
MHAS_04798        CDS       T05715                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mhas  Mycolicibacterium hassiacum
Brite
KEGG Orthology (KO) [BR:mhas00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MHAS_04798 (ahpF)
Enzymes [BR:mhas01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MHAS_04798 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO Thi4 FAD_oxidored AlaDh_PNT_C K_oxygenase Glutaredoxin FAD_binding_3 NAD_binding_8 FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: VCT93060
UniProt: K5BCM1
LinkDB All DBs
Position
1:complement(5100156..5101727)
Genome map
AA seq 523 aa AA seqDB search
MLDASTTAQLKTYLEKVTIPIELVASLDDTPKSAELAELLTETAALSDKVTYRRADDEAR
RPSFRIQRVGTDIGVQFAGIPMGHEFSSYVLALLQVGGHPVKISDELADTIKNLDGDYLF
ETYLSLSCQNCPDVVQAINAMSVLNPRIRAVAIDGALFRDEVEQRQVLAVPTVFLNGELF
DSGRMSIEQIVAKLDSGAAAREAEKMKGKDPFDVLVVGAGPAGATAAIYAARKGLRTGMA
GERIGGQVLDTMAIENFISVPHTEGPQLAAALEAHVREYEVDIMPMQEAVELIPATEEGG
LTEVRFRNGATLSARSVVLATGARWRTMNVPGEQEYRNKGVTFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGVVGHVTLLEFDNKLRADAVLQRKLHSLPNVDVIVSAATTEVIGDG
AKVTGLRYRDRDTDELRELALEGVFVQIGLLPNTEWLKGTIELSERGEIVVNDRGATSAP
GVFAAGDCTTTPFKQIVIAMGAGATASLSAFEHLIRTSAPTAA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcctcgaccaccgctcagctcaagacatatctggagaaggtcaccatcccg
atcgagctggtggcctccctcgacgacacccccaagtcggccgagttggccgaactgctc
accgagaccgccgccctgtcggacaaggtgacctaccgccgcgccgacgacgaggcacgc
cggccgtcgttccgcatccagcgcgtcggcaccgacatcggcgtgcagttcgccggcatc
ccgatgggccacgagttcagctcgtatgtgctggccctgctgcaggtcggcggacacccg
gtcaagatctccgacgagctggccgacaccatcaagaacctcgacggcgactacctgttc
gagacctacctgtcgctgtcctgccagaactgcccggacgtcgtgcaggcgatcaacgcg
atgagcgtgctcaacccgcggatccgcgccgtggccatcgacggcgccctgttccgcgac
gaggtcgagcagcgccaggtgctcgcggtgcccacggtgttcctcaacggcgagctgttc
gactccggccgcatgtcgatcgagcagatcgtggccaagctcgacagcggcgccgccgcc
cgcgaggccgagaagatgaagggcaaggacccattcgacgtgctcgtcgtcggtgccggc
ccggccggcgccaccgccgccatctacgccgcccgcaaggggctgcgcaccggcatggcc
ggcgagcggatcggcgggcaggtgctcgacaccatggcgatcgagaacttcatctcggtg
ccgcacaccgagggtccccagctggccgccgcgctcgaggcgcacgtccgcgagtacgag
gtcgacatcatgccgatgcaggaggcggtcgagctgatccccgccaccgaggagggcggg
ctgaccgaggtccggttccgcaacggcgccaccctgtcggcgcggtcggtggtgctggcc
accggtgcccgctggcggaccatgaacgtgccgggtgagcaggagtaccgcaacaagggc
gtcactttctgcccgcactgcgacggcccgctgttcaagggcaagcgggtggccgtcatc
ggcggcggcaactccggtgtcgaggcggccatcgacctggccggcgtggtcggccacgtc
acgctgctggagttcgacaacaagctgcgcgccgacgcggtgctgcagcgcaagctgcac
agcctgcccaacgtcgacgtcatcgtctccgcggcgaccaccgaggtgatcggcgacggc
gccaaggtgaccggtctgcgttaccgcgaccgcgacaccgacgagctgcgcgagctggcc
ctcgagggcgtgttcgtccagatcggcctgctgcccaacaccgaatggctcaagggcacg
atcgagctgtccgagcgcggcgagatcgtcgtcaacgatcgcggagccacctcggcaccc
ggcgtgttcgcggccggcgactgcacgacgacgccgttcaagcagatcgtcatcgcgatg
ggcgccggcgccacggcgtcgctgtcggccttcgaacacctgatccgcacctcggcccca
accgcggcctga

DBGET integrated database retrieval system