KEGG   Mannheimia haemolytica USDA-ARS-USMARC-184: B824_14130Help
Entry
B824_14130        CDS       T03786                                 

Definition
(GenBank) sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
mhat  Mannheimia haemolytica USDA-ARS-USMARC-184
Pathway
mhat00511  Other glycan degradation
mhat00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mhat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    B824_14130
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    B824_14130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:mhat02042]
    B824_14130
Enzymes [BR:mhat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     B824_14130
Bacterial toxins [BR:mhat02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   B824_14130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_3 BNR_2 BNR Autotransporter GA ERp29 UBN_AB
Motif
Other DBs
NCBI-ProteinID: AJE08208
UniProt: A0A0B5BNA6
LinkDB All DBs
Position
1312561..1314948
Genome map
AA seq 795 aa AA seqDB search
MEKMMRKINQLIISPYFFLSILSASANSDFWKSDLNFNLTNITKRVGVDNFTTPVAGEPW
AGIGPNGEAAGTAPLYYSRIPAMQVTEDNKLVVMFDLRWNRAYDQDRIDPGIAISSDGGH
TWTKKTAWSFDRTNHPARRSMDPTLLHNPIDNSLYVMHGTWSMSDQQWYGGRVPHFNSGS
WAATIYKSTDGGLNWEKNTEFSKFSNLDVFSKVTKNGKPTLGFLGGVGSGIVMQDGTLVF
PIQTAHQNGIATTIMYSKDNGKTWEMPEIDNPVAPNQSSLENMVFELEPGKLVMTGRGNS
RWAYSSTDMGKTWELFTPTNGLLPTSSQPTQGSSIYVTLPNGRKVLLISKPDGKNDGWKR
GDITLWMLDAKDPSHKHKVHIIRPGSGNAAGAGYSSLAYKEGNLFVAFENDGDISVKNLT
EHIAEMEAKAIEWGLPDELTPALDKINALPYLNKAQKETLVEKMRRANDTAIAQSFVINK
EMYNLKNNSDELDKLAKNITKALPSQQNIYQRALAYVNKVTNTADTTYLNYNGIMDTYAN
LYESYLALNTKLDFTRYIQKARKFNEYNTDILYRSFDNFFAHYDTGVKHNNLSLGLNTKL
SENLRGGLFFEYSNKNRNSVQIGARAKYEMDNHQLSGFLRYRGVKHKDMLARNNSVDGYL
NYAYRIQLDDKLSISPSVGAYVSRSSRSLIDEDLAINSRTVYASDVGLNIHYKLNDIDAY
IRPSIGFVNGDITLSQSNDMTNTYKIKDKSNVYSVTTGLKKRFANGVALGADFKLHRYGS
QTTESNFGLNVSYNW
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatgatgagaaaaatcaatcagttaatcatatccccatactttttcctaagt
attttatctgcttccgctaactctgatttttggaaaagcgaccttaattttaatctcaca
aatattaccaagcgtgtcggagtcgataactttaccactccagtagctggcgagccttgg
gctggtattggtccaaatggtgaagctgcaggtactgcgccattatattatagccgtatt
ccagctatgcaagttaccgaagataacaaattagttgttatgtttgatttacgctggaat
cgtgcgtatgaccaagatcgtattgatcctggtattgcgatttcttccgatggtggccat
acttggacgaagaaaaccgcttggtcttttgatagaactaatcacccagcacgccgttca
atggatccaacgctattacataatcctattgataatagtttatatgtaatgcacggaact
tggtctatgtcggatcaacaatggtatggtgggcgtgttcctcactttaatagtggcagc
tgggcagctaccatttataaatctactgatggtggtttaaattgggagaaaaatactgag
tttagtaaattcagcaatttagacgtattttctaaagtcaccaaaaatggaaaacctacc
ttaggctttttaggcggggtcggatctggaattgtaatgcaagatggtacgttggttttc
ccaattcaaaccgcacatcaaaatggtattgcgaccactattatgtattctaaggataat
gggaaaacttgggaaatgccagaaattgacaacccagttgcaccgaaccaaagttcttta
gaaaatatggtgtttgaactcgaaccgggtaagctagtgatgactggacgaggaaacagt
cgctgggcatactcttctactgatatgggtaagacctgggaattatttactccaactaat
ggattattaccaactagctcacaaccaactcaaggctcttctatctatgtaacactacca
aatggtcgaaaagtgctactaatctctaaaccagatggaaagaatgatgggtggaaaagg
ggtgatattacactttggatgctagatgcaaaagatccatcgcacaaacacaaggtgcat
attattcgtccaggttcaggtaatgccgctggtgctggttattcctctttagcctataaa
gaagggaatttatttgttgcttttgaaaacgatggtgatatttcagtaaaaaatttaact
gaacatattgctgaaatggaagcaaaagctatcgaatggggattaccagatgaacttact
cctgctttggataaaatcaatgcactgccttatctcaataaagctcaaaaagagacgcta
gtcgaaaaaatgcgtcgtgctaatgatactgcgattgcacaatcttttgtgattaacaaa
gaaatgtataatctgaaaaacaatagtgatgagctggataaattggcaaaaaatattact
aaagcactgccgtctcaacagaatatttatcaaagagccttagcctatgtgaataaagtc
accaatacagcggataccacttatttaaattataatggtattatggatacctatgctaat
ttatatgaaagctatttggctttaaatactaaattagacttcactcgctacatccaaaaa
gcgagaaagttcaatgaatataacactgatattttatatcgtagctttgataatttcttt
gcccattacgacacaggtgtaaaacacaataatctatccttaggcttgaatacaaaatta
agtgagaatttacgtggtggcttattctttgaatacagtaataaaaatcgtaatagcgta
caaattggtgcaagagctaaatatgaaatggataatcaccaactttctggcttcttacgc
tatcgtggcgtaaaacataaagatatgctagcacgtaataacagtgttgatggctaccta
aattatgcttatcgtattcaattagatgataaattaagcattagcccatcagttggtgct
tacgtttcacgttcttctcgctcattaatagatgaagatcttgcgattaatagccgcacg
gtctatgcaagtgatgtaggattgaatatccattataagctaaatgatattgatgcttat
attcgtccaagtataggctttgtcaatggtgatataactttatctcaatctaatgatatg
acaaacacatacaaaataaaggataaaagtaacgtgtattctgtcacgacagggttgaaa
aaacgctttgcaaatggtgtggcattaggggctgatttcaaattacatcgttatggttct
caaactactgaaagtaatttcggtctaaatgtaagttataactggtaa

DBGET integrated database retrieval system