KEGG   Mannheimia haemolytica USDA-ARS-USMARC-184: B824_16260Help
Entry
B824_16260        CDS       T03786                                 

Definition
(GenBank) 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mhat  Mannheimia haemolytica USDA-ARS-USMARC-184
Pathway
mhat00010  Glycolysis / Gluconeogenesis
mhat00260  Glycine, serine and threonine metabolism
mhat00680  Methane metabolism
mhat01100  Metabolic pathways
mhat01110  Biosynthesis of secondary metabolites
mhat01120  Microbial metabolism in diverse environments
mhat01130  Biosynthesis of antibiotics
mhat01200  Carbon metabolism
mhat01230  Biosynthesis of amino acids
Module
mhat_M00002  Glycolysis, core module involving three-carbon compounds
mhat_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mhat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B824_16260
  09102 Energy metabolism
   00680 Methane metabolism
    B824_16260
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B824_16260
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mhat04131]
    B824_16260
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mhat04147]
    B824_16260
Enzymes [BR:mhat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     B824_16260
Membrane trafficking [BR:mhat04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    B824_16260
Exosome [BR:mhat04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   B824_16260
  Exosomal proteins of melanoma cells
   B824_16260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AJE08421
UniProt: A0A0B5BWS6
LinkDB All DBs
Position
1515185..1515868
Genome map
AA seq 227 aa AA seqDB search
MQLVFIRHGFSEWNAKNLFTGWRDVNLTERGIEEAKSAGQKLKAAGFEFDIAFTSVLTRA
IKTCNIVLEESDQLWIPQVKNWRLNERHYGALQGLDKKETAEKYGDEQVHIWRRSYDISP
PDLDPQDPNSAHNDRRYANLPKDLIPNAENLKITLERVLPFWEDHIAPALISGKRVLVTA
HGNSLRALAKHIEGISDADIMDLEIPTGQPLVYELDDNLKVISKRYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagtatttatccgtcacggtttcagtgaatggaatgctaaaaacttatttacc
ggttggcgtgatgttaatttaacagaacgagggattgaagaagcaaaatctgccggtcaa
aaattaaaagcagccggttttgaatttgatattgcgtttacttcggttttaacccgtgcg
atcaaaacttgtaacatcgtattagaagaatcagaccaattatggatccctcaagtgaaa
aactggcgtttaaacgagcgtcactacggtgcattacaaggtttagacaaaaaagaaact
gctgaaaaatatggtgatgaacaggttcacatctggcgtcgttcttatgacatctctcca
ccggatttagacccacaggatccaaactcagcacataacgaccgccgttatgctaactta
ccaaaagatttaattccaaatgcagaaaacctcaaaatcacccttgagcgtgtgttacca
ttctgggaagatcatattgcacctgcattaatttcaggtaaacgcgtattagttactgct
cacggtaactcattacgtgcattagcaaaacacatcgaaggcatttctgatgcagacatt
atggacttagaaatcccaaccggtcagccattagtgtatgaactagatgacaacttaaaa
gtaatcagcaaacgttacttataa

DBGET integrated database retrieval system