KEGG   Mannheimia haemolytica 89010807N lktA-: VK67_03775Help
Entry
VK67_03775        CDS       T03750                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
mhay  Mannheimia haemolytica 89010807N lktA-
Pathway
mhay00550  Peptidoglycan biosynthesis
mhay01100  Metabolic pathways
mhay01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mhay00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VK67_03775
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    VK67_03775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mhay01003]
    VK67_03775
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mhay01011]
    VK67_03775
Enzymes [BR:mhay01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     VK67_03775
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VK67_03775
Glycosyltransferases [BR:mhay01003]
 Polysaccharide
  Bacterial polysaccharide
   VK67_03775
Peptidoglycan biosynthesis and degradation proteins [BR:mhay01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   VK67_03775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB SHOCT
Motif
Other DBs
NCBI-ProteinID: AKA13442
UniProt: A0A248ZZ70
LinkDB All DBs
Position
739284..741848
Genome map
AA seq 854 aa AA seqDB search
MRIAKIIFSALLSLLVLGGVIGGLLYMHFKSDLPDVATLKNVELQQPMQIFTLDGKLIGE
VGEERRIPVKLDDIPPMLVKAILATEDARFYEHKGIDPKGIMRAIWRTSQGDTQGASTIT
QQLAKNFFLTPERSLERKAKEAILALEIEQVLSKNEILELYLNKIYLGYRSHGVAAAAKT
YFNKSLKDLTLSEIAIIAGLPKAPSTMNPLYSVKRAEDRRNVVLGRMLETGDITKEEYEK
AKAEPVVANYYGATLEFRADYVTEMVRQEIVKRYGENIAYNKGLKVYATVLSADQKAAQD
ALRENLIDYDRRHGWRGAEKLWTGSSAWDDEKIIDHLSKLPKSEPFTPAVVMQADKSKYT
ILLANGDISVLKRTNASFAPKGLKAGEQIWVRQNKNREWALGQIPEVNSALVSINSENGA
IESIVGGFSFEQSRFNRATQSLVQVGSAIKPFIYTAAMNKGLSLSTTISDSPIVIKKKGQ
KEWRPKNADGVYGGPLRTRVALGKSKNMVAIRILQMAGIDYVADYLQRFGFNRNQYVATE
SLALGAASFTPLEMARAYAVFNNGGYLIEPYIIDRIIDAQGYELYQANPVVACNSCDSPV
VYPEPKYFESVKIHDEAQVGVQTIANSSNNDDDDVVEDVGDSEPELQANNSEKNAPSLMA
ESSHHIKGLRYAPHVISDELAFLMRSALATAITGEPEYGWRGTSYKMLNTIKRADVGGKT
GTTNNAKATWYAGFGANISTVVYVGFDDNKRVLGRGASGSSTALPAWTNYMKVALSDKPV
EKSTLPKNIIEVNIDPNSGFLGNGRKEYFIKGTEPTKRYIVERAYTEKAPQKTESAPLRL
GLPPPGVLKSGELF
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcgcaaaaataatatttagtgctttactttcactcttggttttaggtggggta
attggtggtttactgtacatgcatttcaaatctgatttgcctgatgtggcaacgctgaaa
aatgtagagttacagcagcctatgcagatttttaccttagatggtaaattaattggtgaa
gtaggagaagaacgccgtattccggtcaagcttgatgatattccaccgatgttagtaaaa
gcgattcttgctaccgaagatgcacgtttttacgagcataaagggatcgatcctaaaggt
attatgcgtgcaatatggcgcactagccagggagatactcaaggcgcaagtacaatcacc
cagcagctggcgaaaaactttttcttaacacctgaacgtagtttagagcgtaaggccaaa
gaggcaattttagctttagaaattgaacaggttctcagtaaaaatgagattctggagctg
tatttaaacaaaatttacctagggtatcgttctcacggtgttgccgctgcggctaaaact
tattttaataaatctttgaaagatttaaccctttctgaaatagcaattattgcagggctt
ccaaaagcgccttcaacgatgaatccactttattcagtaaaacgggcggaagaccgtcgt
aatgtagtgcttgggagaatgctagaaaccggagatattacaaaagaggaatatgagaaa
gctaaagcagagccagtagtagctaactactatggtgcgacattagaatttcgagcggat
tatgtgacagaaatggttcgtcaagaaattgtgaaacgctatggagaaaatattgcttat
aacaaaggcttaaaagtgtacgccacggtactttcagcagaccaaaaagcagcacaagat
gcgttacgtgaaaatttgattgattatgaccgccgtcatggttggcgaggcgctgaaaaa
ttatggacaggtagttctgcttgggacgatgagaaaattatcgatcatttaagtaagctg
ccaaaatcagagccgtttacaccagctgttgtaatgcaagcagataaatcaaaatataca
attttattggcaaatggtgatatctctgttttaaaacgtacaaatgcttcttttgcacct
aaagggttaaaagcaggtgaacaaatttgggtacgtcaaaataaaaatagggagtgggct
ttaggacaaattccggaggtaaattcagccctagtgtcaattaatagtgaaaacggtgcc
attgaatctatcgttggaggctttagctttgaacaaagccgtttcaatcgtgcgactcag
tcattagttcaggtaggctctgcgattaaaccgtttatttacacagcggcaatgaataaa
gggctaagtctttcaacaacaattagcgattctcctattgtcattaaaaagaaagggcaa
aaagagtggcgacctaaaaatgccgatggggtttatggcggcccgttgagaactcgtgtt
gcattaggtaaatcgaaaaatatggtggctattcgtatattacaaatggcagggattgat
tatgttgcagactacttacaacgttttggctttaaccgaaatcagtatgttgcaacagaa
tctcttgcattgggtgctgcatcttttacgccattagaaatggctcgagcttatgcagta
tttaataatggaggttatttgattgaaccatatatcattgaccgtattattgatgcccaa
ggctacgagttatatcaagcaaatcctgtagtagcttgtaatagttgcgatagcccagtt
gtttaccctgagcctaaatattttgaatcagtcaaaattcatgatgaagctcaagtcggt
gtacaaactatagcgaattcctcgaataatgatgacgacgatgttgtggaagatgttggc
gattcagaacctgaattacaagcgaacaatagcgagaaaaatgcgccgagcttaatggca
gaatcttctcatcatatcaaagggttacgttacgctcctcatgttattagtgatgaactc
gcttttttaatgcgtagtgctttagctacagcaattactggtgagcctgaatatggctgg
cgaggaacaagctataaaatgctcaatacgataaaacgagcggatgtgggcgggaagact
ggtacaaccaataatgccaaggcaacttggtatgcgggatttggtgctaatatttctact
gttgtgtacgttggctttgatgataataaaagagtattaggtagaggtgcttcaggttct
agtactgctttaccagcttggacaaattatatgaaagttgcattgtcagataagcctgtc
gaaaaaagtacccttccaaaaaatattattgaggttaatattgaccctaatagtggtttc
ttaggaaatggacgtaaagagtattttattaagggtactgagcctacaaaacgttatatt
gtagagagagcttatactgaaaaagcgcctcaaaaaacagaatctgcgccgttacgttta
ggattacctccaccaggggtgctaaaaagcggtgaattattctaa

DBGET integrated database retrieval system