KEGG   Mannheimia haemolytica 89010807N lktA-: VK67_03780Help
Entry
VK67_03780        CDS       T03750                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mhay  Mannheimia haemolytica 89010807N lktA-
Pathway
mhay00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mhay01100  Metabolic pathways
mhay01110  Biosynthesis of secondary metabolites
mhay01130  Biosynthesis of antibiotics
mhay01230  Biosynthesis of amino acids
Module
mhay_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mhay00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VK67_03780 (aroK)
Enzymes [BR:mhay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     VK67_03780 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_18 AAA_33 Cytidylate_kin dNK AAA TsaE AAA_17 Thymidylate_kin AAA_22 AAA_24 AAA_23 AAA_16 AAA_28 AAA_5 Ploopntkinase3 CoaE Mg_chelatase ABC_tran AAA_29 AAA_PrkA APS_kinase RNA_helicase GTP_EFTU G-alpha AAA_7 Rad17 IstB_IS21
Motif
Other DBs
NCBI-ProteinID: AKA13443
UniProt: A0A248ZXL6
LinkDB All DBs
Position
742085..742606
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLIGPMGAGKSTIGRQLAQTLGMEFMDSDSVIEERAGADIDWIFDVEGEEGFR
KREERILNELTQNYGIVLSTGGGSILSKDNRNVLSARGIVIYLETTVDKQFERTQRDKKR
PLLQTEDPRKTLEELAKIRNPLYEEIADITIHTDEQSAKVVANQIIDMIDNLQ
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaacgtaatatttttttgattgggccgatgggagcaggtaaaagtacgatt
ggtcgtcagcttgctcaaacattaggtatggaatttatggattccgacagtgtgatcgaa
gaacgagcaggtgcggatattgattggatcttcgatgttgaaggtgaagagggtttccgt
aagcgtgaagaacgtattctaaatgaactgacgcaaaattatggtatcgtgctttcaact
ggcggtggttcgattttatctaaagataaccgtaatgtgttatcggctcgtggtatcgtt
atttatttagaaacgacagtggataaacagtttgaacgtactcagcgagataaaaaacgc
cctttattgcaaacagaagacccccgtaaaacgttggaagagttagcgaaaatccgtaac
ccattgtatgaagaaattgcagatattactattcatacggacgagcagagcgctaaagta
gtggcaaatcaaattattgatatgattgataatttacagtag

DBGET integrated database retrieval system