KEGG   Mannheimia haemolytica 89010807N lktA-: VK67_13700Help
Entry
VK67_13700        CDS       T03750                                 

Definition
(GenBank) hypothetical protein
  KO
K00048  lactaldehyde reductase [EC:1.1.1.77]
Organism
mhay  Mannheimia haemolytica 89010807N lktA-
Pathway
mhay00630  Glyoxylate and dicarboxylate metabolism
mhay00640  Propanoate metabolism
mhay01100  Metabolic pathways
mhay01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VK67_13700
   00640 Propanoate metabolism
    VK67_13700
Enzymes [BR:mhay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.77  lactaldehyde reductase
     VK67_13700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AKA15268
UniProt: A0A547EE15
LinkDB All DBs
Position
2690756..2691907
Genome map
AA seq 383 aa AA seqDB search
MANRLILNETSYHGKGAIQNIVHEVTSRSFKKALVVTDKDLIKFNVAQKVTALLDAAGLP
YEIFDEVKANPAVDVIKAGVAKFKASSADYLIAIGGGSPIDSAKAIGIIINNPEFSDVLS
LEGVAPTHQKCVPIIAIPTTAGTAAEVTINYVITDEAKKRKFVCVDVHDVPAVALVDPDM
MESMPKSLAAATGMDALTHAIEGYITKAAWELTDALHLKAIELIGRSLRGAVEKNPKDVE
AMALGQYVAGMGFSNVGLGAVHSMAHPLSAYYDTPHGIANAVLLPYVMEFNKNYTGEKYR
EIARAMGVKGVDEMSQEEYRNAAIAAVQQLSQDVGIPPKLHQIGVKEADLAALSVDAFND
VCTGGNPRDCTAEELLEVYRIAY
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcgtcttatcctcaatgaaaccagttaccacggcaaaggagcaatccaaaat
attgttcacgaagtgaccagccggagtttcaaaaaagcccttgtggtaacagacaaagac
ctgatcaaatttaacgttgcccaaaaagtcaccgccttgcttgatgccgcaggcttgcct
tatgagattttcgatgaggtcaaagccaacccggcagtcgatgtgatcaaagcgggggtc
gcaaaattcaaagcctccagtgccgattatttaattgcgattggtggcggctcaccgatt
gatagtgccaaagcgattggtattatcatcaataaccctgagtttagcgatgtactttca
ttggaaggtgtcgccccaacccaccaaaaatgtgtgccgattatcgccattccaactacc
gcaggtacagccgcagaagtcacgattaactatgtcattaccgatgaagcgaaaaaacgc
aaatttgtgtgcgtggacgttcacgatgtgccggcagtggcgttagtcgatccagatatg
atggaatctatgccgaaaagcttggctgccgcaaccggtatggacgctctcacccacgcc
attgaaggctacattaccaaagcggcgtgggaattaaccgatgctctacaccttaaagcg
attgagctgatcggccgttcattgcgtggtgcagtggagaaaaatccgaaagatgtcgag
gcaatggcattgggacaatatgtggctggaatgggcttctccaacgttgggcttggcgcg
gttcacagtatggcacacccgctttctgcctattacgacaccccacacggcattgccaac
gcagtattactgccgtatgtgatggaatttaataaaaattacaccggcgaaaaataccgt
gaaattgcccgagcaatgggggtaaaaggcgtagatgaaatgagccaagaagagtaccgc
aacgccgccattgctgccgtacaacagctttcacaagatgtcggcattccgccaaaactg
catcaaatcggcgttaaagaagccgatttagcggcattatcggtcgatgcctttaatgat
gtctgcaccggtggcaacccgagagattgtacggctgaggagctgttggaggtatatcgg
atcgcatactaa

DBGET integrated database retrieval system