KEGG   Methanohalophilus halophilus: BHR79_03400Help
Entry
BHR79_03400       CDS       T04572                                 

Definition
(GenBank) RNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mhaz  Methanohalophilus halophilus
Brite
Enzymes [BR:mhaz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BHR79_03400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: APH38626
UniProt: A0A1L3Q178
LinkDB All DBs
Position
697104..698270
Genome map
AA seq 388 aa AA seqDB search
MKGSEKPELDMEKTARFLGLSVSRLERLFEKRLLSRNWGKYTNFFRFETSVSGIERGSVL
LQKRDGKLDLILGFPKIQRAMLLEPSINNHFSEIDKLIVEEKMNGYNVRVIENAGKLIAF
TRSGHICPYSTEKVNYLLDPSFFRQYPDLVVHGEMAGPENPYVSKKVYDTQTLDFFVFDI
RHKKTGQPLQVKQRRKLANTFGFKQVPFLGEFARKEAAEKIMQIIKKLGEMKHEGVVIKD
LDMDLAPIKYTCSQSNCADLEHAFKFYNEVGRDYLYSRVVREGFQTVEWDEDEDTMDKRC
LRLGRSIISPMADSVRRVGNGEKLYDEITLRFESPQTLQEFEEYFRRLGIDATFDRLGYS
GGEIMVNLQKLNQSTTDKTESMWEGNLW
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttcggagaaaccggaacttgatatggaaaagacagcccgttttttagggctg
tcagtctccagactggaaaggctgtttgaaaaaagactcctatcaagaaactggggaaag
tacacgaattttttcaggttcgaaacttctgtctcaggtatagaaagaggaagtgtgctc
ctgcaaaagcgcgatggaaaactggatttaatcctgggtttcccaaaaatacagcgtgca
atgctgcttgagccttctataaataaccatttttcagaaattgataaactcatagtcgaa
gaaaagatgaacggctataatgtccgtgtaattgaaaacgcagggaaacttatcgctttc
acccgcagcgggcatatctgtccctattccacagaaaaagtcaattatcttttagacccc
tcctttttcagacaatatcctgacctggtagtgcacggggaaatggcaggccccgagaac
ccttatgtctccaaaaaagtctacgatacacagacactggattttttcgtcttcgatata
cgccataaaaagactggacaacccctgcaggtcaaacaaagaagaaaactggccaacacc
tttggttttaagcaggttcctttcctgggagagtttgcaaggaaagaggctgctgaaaag
attatgcaaattataaaaaaactgggggaaatgaaacatgaaggggtggtcatcaaggat
ttggatatggacctggcacctatcaaatacacatgttctcagagtaattgcgccgacctt
gaacatgctttcaagttctacaacgaggtgggacgggattacctgtattccagggtagtc
agggaaggtttccagaccgtggaatgggatgaagacgaagatacaatggataaacgatgc
ttaaggcttggcagaagcatcatctctcctatggccgattctgtccgaagggttggcaac
ggtgaaaaactctatgatgagatcaccctgcggtttgagagtccacaaaccctgcaggaa
tttgaggaatatttccgccggcttggaatagatgctacttttgaccggctgggatattca
ggcggagaaattatggttaacctccaaaaactcaaccagagtaccaccgacaagaccgaa
tcaatgtgggaaggcaacctctggtaa

DBGET integrated database retrieval system